Recombinant Geobacter lovleyi ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

ATP synthase subunit a (atpB) is encoded by the atpB gene (UniProt ID: B3E9X3) and functions as a proton channel within the F0 sector of ATP synthase. Structural studies of bacterial ATP synthases reveal that subunit a interacts with the c-ring rotor to facilitate proton translocation, enabling ATP production . In Geobacter lovleyi, this enzyme supports metabolic versatility, including organohalide respiration and uranium reduction .

Key Features:

PropertyDescription
Gene LocusGlov_3142 (chromosomal)
Protein Length230 amino acids (full-length)
Post-Translational TagsN-terminal His tag for purification
Expression SystemEscherichia coli (optimized for soluble expression)
Storage ConditionsTris-based buffer with 50% glycerol; stable at -20°C to -80°C

Genomic and Metabolic Context

Geobacter lovleyi strain SZ, the source organism, possesses a 3.9 Mbp chromosome (54.8% GC) and a 77 kbp plasmid (pSZ77) . While pSZ77 encodes partial cobalamin biosynthesis genes, subunit a is chromosomally encoded and conserved across Geobacteraceae . Key genomic insights:

  • Organohalide Respiration: Linked to a laterally acquired chromosomal genomic island encoding reductive dehalogenases (RDases) .

  • Metal Reduction: Retains c-type cytochromes for U(VI) reduction despite gene loss in oxidative stress pathways .

Recombinant Production and Applications

Recombinant atpB is produced for structural and functional studies.

Production Details:

ParameterSpecification
Expression HostE. coli
Purity>85% (verified by SDS-PAGE)
SequenceIncludes residues 1–229 (C6E8P0 in Geobacter sp.) or 1–230 (B3E9X3)
ApplicationsEnzyme kinetics, antibody development, and membrane protein studies

Biotechnological Relevance

  • Bioremediation: G. lovleyi’s dual capacity for PCE dechlorination and U(VI) reduction makes atpB a target for enhancing electron transport in contaminated environments .

  • Antibacterial Potential: While not directly observed in Geobacter, ATP synthase subunits in other species (e.g., zebrafish ATP5A1) exhibit antimicrobial activity, suggesting unexplored roles .

Comparative Genomics

G. lovleyi’s ATP synthase shares core features with Geobacter sulfurreducens but lacks accessory c-type cytochromes, emphasizing functional divergence within the genus .

FeatureG. lovleyi Strain SZG. sulfurreducens PCA
Genome Size3.9 Mbp3.8 Mbp
PlasmidpSZ77 (77 kbp)Absent
c-Type Cytochromes49 genes>100 genes
Electron AcceptorsPCE, U(VI), Fe(III)Fe(III), Mn(IV), AQDS

Research Challenges and Future Directions

  • Structural Resolution: Cryo-EM studies of Geobacter ATP synthase remain limited compared to Bacillus models .

  • Genetic Tools: Plasmid pSZ77’s role in cobalamin biosynthesis warrants exploration for optimizing recombinant protein yields .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Glov_3142; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Target Names
atpB
Target Protein Sequence
MVHPLLFLQFLSTKLQHLLHISDASANAVVYTWTVIVLLLVLSLIATRALKTIPSGVQNF MEVVVDGIENMIVETMGEHGRSFFPLIATLAIFILVSNLVGLIPGFYPPTANVNTTAACA IVVFLATHVVGIKHHGFHYLKHFMGPIWWLAPLMFFIEVIGHLSRPVSLTLRLFGNMNGH ELVLMIFFALAPFLVPLPMMLMGVLVSFIQAFVFMLLAMIYIQGSLEEAH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel, directly involved in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase and what is its functional significance in Geobacter lovleyi?

ATP synthase is a crucial rotatory molecular machine responsible for producing adenosine triphosphate (ATP), the universal energy currency used in biochemical reactions that sustain cellular functions. This enzyme contains two major components: F0, an electric rotary motor located in the membrane with an ion pump to facilitate proton transfer across cell membranes, and F1, a chemical rotary motor that catalyzes ATP synthesis .

In Geobacter species, including G. lovleyi, ATP synthase plays a particularly important role in energy conservation during unique respiratory processes. Geobacter species are significant for their bioremediation capabilities in contaminated environments and their ability to produce electricity from waste organic matter . The ATP synthase in these organisms is therefore essential for coupling the electron transport processes to energy conservation.

What are the structural characteristics of ATP synthase subunit a (atpB) in Geobacter lovleyi?

ATP synthase subunit a (atpB) is a membrane-embedded component of the F0 sector of ATP synthase in Geobacter lovleyi. According to available structural data, this subunit plays a crucial role in proton translocation across the membrane, which drives the rotary mechanism of ATP synthesis . The recombinant form of this protein is available as a partial sequence with UniProt accession number B3E9X3 .

The protein functions as part of the membrane-embedded proton channel, working in conjunction with the c-ring to facilitate proton movement through the F0 sector. This proton movement ultimately powers the conformational changes in the F1 sector that lead to ATP synthesis .

How do ATP synthase subunit a (atpB) and subunit b (atpF) differ in structure and function?

ATP synthase subunit a (atpB) and subunit b (atpF) serve distinct roles within the ATP synthase complex:

FeatureSubunit a (atpB)Subunit b (atpF)
UniProt IDB3E9X3 B3EA05
LocationMembrane-embedded in F0 sectorPeripheral stalk connecting F0 to F1
FunctionForms proton channel with c-ringForms stator, preventing F1 rotation with c-ring
LengthPartial (as available recombinant) Full length (1-200 amino acids)
SequenceNot fully provided in resourcesMLIQNDRRMQRILSGLAVAVAILVPVLALASGGGEHHPDSGAQLKDFGWRVVDFALLAGI MIWALKKANVKGSLAERQLQIEKNLREAREARETAEAKLKEYTEKLEKANQEVDTLRAAM LKEAEAEKQRIVAEAQAAAAKVTEQAAQAADQEVLKARTELRVEAARLAVELAGGKLGAA VQKADHDRFVQDYLGKVVQL

While subunit a forms part of the proton channel essential for ATP synthesis, subunit b is crucial for the structural integrity of the complex, connecting the membrane-embedded F0 sector to the catalytic F1 sector and serving as a stator to prevent the entire F1 portion from rotating with the c-ring during ATP synthesis .

What expression systems are commonly used for producing recombinant Geobacter lovleyi ATP synthase subunits?

Based on the available data, two primary expression systems are employed for the production of recombinant Geobacter lovleyi ATP synthase subunits:

  • E. coli expression system: This bacterial system has been used for expressing ATP synthase subunit b (atpF), as evidenced by the recombinant protein being "fused to N-terminal His tag, was expressed in E. coli" . This system is advantageous for its high yield, ease of culture, and well-established protocols.

  • Baculovirus expression system: For ATP synthase subunit a (atpB), baculovirus-based expression has been documented . This insect cell-based system is particularly valuable for expressing membrane proteins that may not fold correctly in bacterial systems.

The choice between these systems depends on various factors including the specific protein characteristics, required post-translational modifications, and downstream applications. For structural studies and functional assays, proper protein folding is critical, making the expression system selection a crucial consideration for researchers working with these proteins .

What are the optimal conditions for functional assays of recombinant Geobacter lovleyi ATP synthase subunit a?

When conducting functional assays with recombinant Geobacter lovleyi ATP synthase subunit a (atpB), several critical parameters must be optimized:

Reconstitution Protocol:

  • Begin with proper reconstitution of the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration between 5-50% (with 50% being common) for long-term storage stability

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles, as these can significantly impact protein activity

Storage Conditions:

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, maintain at -20°C/-80°C, with shelf life of approximately 12 months for lyophilized form and 6 months for liquid form

Activity Assay Considerations:

  • When measuring ATP synthase activity, consider reconstituting the protein into liposomes to create a proton gradient

  • For isolated subunit studies, interaction assays with complementary subunits may be necessary as the isolated subunit a typically cannot function independently

  • Control experiments should include denatured protein samples and samples without proton gradient to establish baseline activities

The measurement of functional activity is challenging for isolated subunits, as they typically function as part of the larger ATP synthase complex. Researchers often need to either reconstitute partial or complete complexes or use specialized assays designed to detect specific aspects of subunit function, such as proton conductance or interaction with other subunits .

How can structural studies of ATP synthase contribute to understanding its molecular mechanism in Geobacter species?

Structural studies of ATP synthase from Geobacter species can provide crucial insights into several aspects of its molecular mechanism:

  • Conformational Dynamics: High-resolution structures at different stages of the catalytic cycle can reveal the conformational changes that occur during ATP synthesis. This is essential for understanding how proton translocation through F0 drives the rotary motion that powers ATP synthesis in F1 .

  • Species-Specific Adaptations: Comparative structural analysis of ATP synthases from different organisms, including Geobacter, can reveal adaptations specific to their ecological niches and metabolic capabilities. For Geobacter species, which thrive in anaerobic environments and participate in extracellular electron transfer, these adaptations may be particularly significant .

  • Drug Design Targets: As demonstrated with other bacterial ATP synthases (e.g., in mycobacteria), high-resolution structural data can guide the development of specific inhibitors. This approach has been successful in creating antibiotics like bedaquiline for tuberculosis treatment .

To effectively study the structure, researchers should consider:

  • Cryo-electron microscopy (cryo-EM) for whole complex visualization

  • X-ray crystallography for high-resolution studies of isolated components

  • Nuclear magnetic resonance (NMR) for dynamics studies of smaller subunits

  • Molecular dynamics simulations to understand conformational changes

These approaches together can provide a comprehensive understanding of how ATP synthase functions in Geobacter species, potentially revealing unique features that contribute to their distinctive metabolic capabilities .

What experimental approaches can be used to study ATP synthase in relation to Geobacter lovleyi's unique metabolic capabilities?

Studying ATP synthase in the context of Geobacter lovleyi's distinctive metabolic traits requires integrated experimental approaches:

Genetic Manipulation Strategies:

  • Gene knockout or replacement studies, similar to those described for other genes in Geobacter species, where the target gene is replaced with a kanamycin resistance gene using double-crossover homologous recombination

  • Controlled gene expression using inducible promoters (e.g., IPTG-inducible systems as mentioned for other Geobacter genes)

  • Site-directed mutagenesis to modify specific residues and assess their functional significance

Metabolic Analysis Techniques:

  • Respiration rate measurements during different growth conditions

  • Membrane potential assessments using fluorescent probes

  • ATP production quantification during extracellular electron transfer processes

  • Isotope labeling to track energy flow through metabolic pathways

Integrative Approaches:

  • Transcriptomic analysis to monitor ATP synthase gene expression under various environmental conditions

  • Proteomics to assess ATP synthase protein levels and post-translational modifications

  • Metabolomics to observe global metabolic changes in response to ATP synthase modifications

  • In situ gene expression analysis using molecular techniques like those mentioned for "molecular (mRNA) analysis of in situ rates of metal reduction from levels of expression of key respiratory genes"

These approaches can help elucidate how ATP synthase contributes to Geobacter lovleyi's ability to perform bioremediation and generate electricity from organic waste, processes that rely heavily on efficient energy conservation mechanisms .

How can site-directed mutagenesis be applied to investigate critical functional residues in ATP synthase subunit a?

Site-directed mutagenesis represents a powerful approach for investigating specific amino acid residues in ATP synthase subunit a (atpB) that are critical for function:

Target Selection Strategy:

  • Prioritize conserved residues identified through multiple sequence alignments of ATP synthase subunit a across species

  • Focus on charged residues (Arg, Asp, Glu, Lys) that may participate in proton translocation

  • Target residues at the interface with the c-ring, which are likely involved in the proton channel

  • Investigate residues unique to Geobacter lovleyi that may contribute to its specific adaptations

Mutagenesis Workflow:

  • Design primers containing the desired mutations, similar to the PCR-based approaches described for other Geobacter genes

  • Amplify the modified gene segments

  • Perform recombination into appropriate vectors

  • Transform into expression hosts

  • Confirm mutations by sequencing

Functional Assessment Methods:

  • Membrane incorporation assays to determine if mutations affect proper folding and localization

  • Proton translocation measurements using pH-sensitive fluorescent dyes

  • ATP synthesis activity assays with reconstituted proteoliposomes

  • Protein-protein interaction studies to assess effects on complex assembly

Expected Outcomes:
Mutations in critical residues may result in:

  • Complete loss of function (for essential residues)

  • Altered proton translocation kinetics

  • Changed pH dependency of activity

  • Modified interaction with other subunits

  • Shifted energy coupling efficiency

This approach has been successfully applied to ATP synthases from other organisms and can provide valuable insights into the structure-function relationships specific to Geobacter lovleyi ATP synthase subunit a .

What protocols are recommended for purification and reconstitution of Geobacter lovleyi ATP synthase subunit a?

The purification and reconstitution of Geobacter lovleyi ATP synthase subunit a requires careful attention to maintain protein integrity and function:

Purification Protocol:

  • Initial Processing: If working with commercially available recombinant protein, briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitution: Dissolve lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Stabilization: Add glycerol to a final concentration of 5-50% (with 50% being standard) for stability

  • Quality Assessment: Verify purity through SDS-PAGE (>85% purity is typically achieved)

For Researchers Expressing the Protein:

  • Expression System Selection: Consider baculovirus expression system, which has been documented for atpB

  • Cell Lysis: Use gentle detergents suitable for membrane proteins

  • Affinity Purification: Utilize tag-based purification methods (specific tag type determined during manufacturing)

  • Detergent Exchange: If functional studies are planned, exchange harsh detergents with milder ones

Functional Reconstitution:

  • Liposome Preparation: Create liposomes with lipid composition mimicking bacterial membranes

  • Protein Incorporation: Add purified protein in appropriate detergent

  • Detergent Removal: Use BioBeads, dialysis, or gel filtration

  • Verification: Confirm incorporation through freeze-fracture electron microscopy or functional assays

The reconstitution into liposomes is particularly important for functional studies, as ATP synthase subunit a is a membrane protein that requires a lipid environment to maintain its native conformation and function .

What techniques can be employed to measure the activity of recombinant ATP synthase subunits?

Measuring the activity of recombinant ATP synthase subunits, particularly subunit a (atpB), requires specialized techniques due to its role within the larger complex:

Direct Activity Measurements:

  • ATP Synthesis Assays: For reconstituted complexes, measure ATP production using luciferase-based luminescence assays when a proton gradient is applied

  • ATP Hydrolysis Assays: Measure phosphate release using colorimetric methods like malachite green

  • Proton Pumping Assays: Use pH-sensitive fluorescent dyes to monitor proton movement across membranes

Indirect Functional Assessments:

  • Binding Assays: Measure interaction with other ATP synthase subunits using techniques like:

    • Surface plasmon resonance (SPR)

    • Isothermal titration calorimetry (ITC)

    • Pull-down assays with tagged proteins

  • Conformational Analysis: Monitor structural integrity and conformational changes using:

    • Circular dichroism (CD) spectroscopy

    • Fluorescence spectroscopy

    • Limited proteolysis followed by mass spectrometry

In vitro Translation Systems:
Similar to approaches used for other ATP synthase studies, in vitro translation followed by association studies can reveal important aspects of subunit assembly. For example, research with Chlamydomonas chloroplast ATP synthase demonstrated that "Translation in the presence of thylakoids resulted in association of the beta subunit with the membrane" and that "the in vitro synthesized polypeptide bound to the membrane copurified with CF1 on sucrose gradients" . Similar approaches could be adapted for Geobacter lovleyi ATP synthase.

These techniques can be combined to provide a comprehensive understanding of subunit function, particularly when working with isolated subunits that may not display full activity outside the complete complex .

What molecular biology techniques are most effective for studying ATP synthase gene expression in Geobacter species?

For investigating ATP synthase gene expression in Geobacter species, several molecular biology techniques have proven effective:

Gene Expression Analysis:

  • Quantitative PCR (qPCR): For precise quantification of ATP synthase gene transcripts

  • RNA-Seq: For genome-wide expression patterns, placing ATP synthase gene expression in broader context

  • Northern Blotting: For specific detection of ATP synthase mRNA size and abundance

  • In situ Molecular Analysis: As indicated in the research, "Molecular (mRNA) analysis of in situ rates of metal reduction from levels of expression of key respiratory genes" can reveal environmental influences on gene expression

Promoter Analysis Techniques:

  • Reporter Gene Assays: Similar to those described for Geobacter, where "promoter regions... were amplified by primers" and cloned into reporter plasmids

  • Deletion Analysis: Creating targeted deletions in promoter regions to identify regulatory elements

  • Footprint Assays: To determine binding sites for regulatory proteins, as mentioned in Geobacter research where "the effects of the binding site determined by the footprint assay on the promoter activity" were examined

Genetic Manipulation Approaches:

  • Gene Knockout: Using "double-crossover homologous recombination... by electroporation with the linear DNA fragment consisting of the kanamycin resistance gene flanked by DNA fragments"

  • Overexpression Systems: Similar to the approach where "Overproduction of HgtR was achieved by growing in NBAF media supplemented with kanamycin and IPTG"

  • Site-Directed Mutagenesis: For targeted modifications of regulatory regions

These molecular biology techniques can provide valuable insights into how ATP synthase gene expression is regulated in Geobacter species under different environmental conditions, including those relevant to bioremediation applications .

How can proteomic approaches be applied to study post-translational modifications of ATP synthase subunits?

Proteomic approaches offer powerful tools for investigating post-translational modifications (PTMs) of ATP synthase subunits in Geobacter lovleyi:

Sample Preparation Strategies:

  • Enrichment Methods:

    • Subcellular fractionation to isolate membrane proteins

    • Immunoprecipitation using antibodies against ATP synthase subunits

    • Affinity purification using ATP synthase inhibitors or substrates

  • Digestion Protocols:

    • In-gel digestion of SDS-PAGE separated proteins

    • On-bead digestion of affinity-purified complexes

    • Filter-aided sample preparation (FASP) for membrane proteins

Mass Spectrometry Approaches:

  • Bottom-up Proteomics:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • Multiple reaction monitoring (MRM) for targeted analysis

    • Data-dependent acquisition (DDA) for discovery

  • Top-down Proteomics:

    • Intact protein mass spectrometry to preserve PTM combinations

    • Electron transfer dissociation (ETD) for PTM site localization

  • PTM-Specific Methods:

    • Phosphoproteomics using titanium dioxide or immobilized metal affinity chromatography

    • Glycoproteomics using lectin affinity chromatography

    • Redox proteomics to detect oxidative modifications

Data Analysis Workflows:

  • Identification Software:

    • Database search algorithms with PTM options enabled

    • Open search approaches for unexpected modifications

  • Quantification Methods:

    • Label-free quantification

    • Stable isotope labeling (SILAC, TMT, iTRAQ)

  • Bioinformatic Analysis:

    • PTM site prediction tools

    • Structural mapping of modified residues

    • Pathway analysis for functional context

By applying these proteomic approaches, researchers can identify PTMs that may regulate ATP synthase activity in response to environmental conditions relevant to Geobacter lovleyi's unique metabolic capabilities, such as extracellular electron transfer during bioremediation processes .

How does ATP synthase function contribute to Geobacter lovleyi's bioremediation capabilities?

ATP synthase plays a crucial role in supporting Geobacter lovleyi's bioremediation capabilities through several interconnected mechanisms:

Energy Conservation During Anaerobic Respiration:

  • Geobacter species are known for their ability to perform bioremediation of contaminated environments, particularly through reduction of metal contaminants

  • During these processes, ATP synthase couples the energy released from electron transfer to ATP production, providing the cellular energy required to sustain bioremediation activities

  • This energy coupling maintains the proton motive force necessary for cellular functions while Geobacter species reduce environmental contaminants

Metabolic Integration:

  • ATP synthase functions as part of a broader metabolic network that includes "genome-wide gene regulation of biosynthesis and energy generation"

  • This integration allows Geobacter lovleyi to adapt its energy conservation strategies to different environmental conditions, optimizing bioremediation performance

  • The enzyme's activity directly influences the cell's capacity to synthesize proteins and maintain cellular processes necessary for contaminant transformation

Environmental Adaptation Mechanisms:

  • ATP synthase activity may be regulated in response to "environmental stresses" and "nutrient requirements"

  • This regulation enables Geobacter lovleyi to maintain energy homeostasis during bioremediation processes that may involve fluctuating conditions

  • Understanding these adaptations can help researchers develop strategies for "in situ control or remediation of contaminated sites"

Research into ATP synthase function in Geobacter lovleyi can contribute to "prediction of fate of contaminants under natural attenuation or engineered" approaches, potentially improving bioremediation strategies .

What structural features of ATP synthase make it a potential target for biotechnological applications?

ATP synthase possesses several structural features that make it a compelling target for biotechnological applications, particularly in the context of Geobacter lovleyi's unique capabilities:

Rotary Mechanism and Energy Efficiency:

  • ATP synthase functions as a "unique rotatory molecular machine" with remarkable efficiency in converting proton gradient energy into chemical energy (ATP)

  • This mechanical feature could be exploited in bio-inspired nano-motors or energy conversion devices

  • Understanding the structural basis of this efficiency could inspire the design of artificial energy transduction systems

Modular Architecture:

  • The complex consists of distinct functional modules (F0 and F1) that can potentially be modified independently

  • This modularity allows for targeted engineering of specific functions, such as:

    • Altering substrate specificity

    • Modifying regulatory properties

    • Creating chimeric complexes with novel functions

  • The membrane-embedded F0 sector could be engineered for specific membrane integration in synthetic biology applications

Species-Specific Adaptations:

  • Geobacter lovleyi ATP synthase may possess structural adaptations that enable function in environments relevant to bioremediation and electricity generation

  • These adaptations could potentially be transferred to other systems to enhance performance in similar conditions

  • Comparative structural analysis can reveal these unique features: "We demonstrate the similarities in structural organization of various ATP synthases found in the representatives of different phylogenetic groups"

Drug Development Potential:

  • High-resolution structural data can facilitate "F0F1-structure-based approach to design new therapies"

  • Similar to how bedaquiline was developed for tuberculosis based on mycobacterial ATP synthase structure, Geobacter ATP synthase could serve as a template for designing compounds that modulate bioremediation activities

  • Such structure-based approaches require "information on high-resolution structural data of different families of F0F1"

These structural features make ATP synthase a promising target for various biotechnological applications, from bioremediation enhancement to bio-inspired energy conversion systems .

How can recombinant ATP synthase components be utilized in structural biology studies?

Recombinant ATP synthase components from Geobacter lovleyi offer valuable resources for structural biology studies through multiple complementary approaches:

X-ray Crystallography Applications:

  • Purified recombinant subunits like atpB and atpF can be used for crystallization trials

  • This approach has historically been important, as "the first high-resolution structure (2.8 Å) of the F1 part... was solved by X-ray diffraction (XRD) crystallography technique"

  • While "crystallization of the whole F0F1 ATP synthase is still a challenge," individual subunits may crystallize more readily

  • Specific considerations for Geobacter lovleyi ATP synthase subunits include:

    • Optimization of detergent types for membrane components

    • Screening for stabilizing conditions during crystallization

    • Use of antibody fragments or fusion partners to aid crystallization

Cryo-Electron Microscopy (cryo-EM) Approaches:

  • Recombinant subunits can be reconstituted into larger subcomplexes or full complexes for cryo-EM analysis

  • This technique has become increasingly important for membrane protein structural studies

  • For Geobacter lovleyi ATP synthase, both the atpB (subunit a) and atpF (subunit b) recombinant proteins could be combined with other components to rebuild complexes for structural analysis

NMR Spectroscopy Applications:

  • Smaller domains or subunits (or fragments thereof) can be isotopically labeled for solution NMR studies

  • This approach can provide valuable information about dynamics and conformational changes

  • The amino acid sequence information available for atpF (full sequence) and atpB (partial) can guide the design of constructs suitable for NMR studies

Integrative Structural Biology:

  • Combining multiple techniques (X-ray, cryo-EM, NMR, modeling) can overcome limitations of individual methods

  • Recombinant subunits can serve as building blocks for hybrid approaches

  • This integrative strategy is particularly important for complex molecular machines like ATP synthase, where understanding "molecular mechanisms of stabilization of the ATP synthase during two synchronized rotation processes" requires multiple structural perspectives

The availability of recombinant Geobacter lovleyi ATP synthase subunits with high purity (>85% by SDS-PAGE) provides researchers with valuable starting materials for these structural biology approaches.

What challenges exist in expressing and purifying functional ATP synthase subunits for research?

Researchers face several significant challenges when expressing and purifying functional ATP synthase subunits from Geobacter lovleyi:

Expression System Optimization:

  • Membrane Protein Solubility Issues:

    • Subunit a (atpB) is a highly hydrophobic membrane protein that often aggregates during expression

    • Selection between E. coli and baculovirus systems must be optimized for each subunit

    • Expression levels may be limited by toxicity to host cells

  • Proper Folding Concerns:

    • Ensuring native conformation is critical, especially for membrane-embedded components

    • The absence of Geobacter-specific chaperones in heterologous expression systems may affect folding

    • Expression temperature, induction conditions, and host strain selection all require careful optimization

Purification Challenges:

  • Detergent Selection:

    • Maintaining protein stability while extracting from membranes requires screening multiple detergents

    • Too harsh detergents may denature the protein, while insufficient detergent leads to poor extraction

    • Detergent concentration must be carefully controlled throughout purification

  • Stability During Processing:

    • As noted in the product information, "Repeated freezing and thawing is not recommended"

    • Working aliquots should be stored at 4°C for up to one week

    • Long-term storage requires stabilization with glycerol (5-50% final concentration)

Functional Validation Difficulties:

  • Subunit Interdependency:

    • Individual subunits like atpB may not display activity without other complex components

    • Reconstitution into functional subcomplexes may be necessary for activity assays

    • Interaction partners may be required for stability

  • Assay Development:

    • Specialized assays must be developed to measure specific aspects of subunit function

    • For atpB (subunit a), proton channel activity measurement requires liposome reconstitution

    • Control experiments must account for background activity and non-specific effects

Technical Solutions Table:

ChallengeApproachRationale
Poor expressionCodon optimizationAdapts to host codon usage bias
Fusion tagsEnhances solubility and expression
Inducible promotersControls expression timing
AggregationDetergent screeningIdentifies optimal solubilization conditions
Co-expression with chaperonesAssists proper folding
Lower expression temperatureSlows folding to reduce aggregation
InstabilityGlycerol addition (5-50%)Stabilizes protein structure
Avoid freeze-thaw cyclesPrevents denaturation
Optimal buffer compositionMaintains native-like environment

Addressing these challenges requires systematic optimization and careful handling throughout the expression, purification, and storage processes .

How might comparative studies of ATP synthase across Geobacter species inform bioremediation strategies?

Comparative studies of ATP synthase across different Geobacter species can provide valuable insights that directly inform bioremediation strategies:

Species-Specific Adaptations:

  • Different Geobacter species have evolved to thrive in various environmental niches, likely with corresponding adaptations in their ATP synthase complexes

  • Comparing ATP synthase sequences, structures, and functions across species can reveal adaptations related to:

    • Temperature tolerance

    • pH adaptability

    • Metal resistance mechanisms

    • Energy efficiency under nutrient limitation

  • These adaptations could inform the selection of optimal Geobacter species for specific bioremediation challenges

Regulatory Mechanisms:

  • Comparing how ATP synthase expression and activity are regulated across species can reveal:

    • Environmental sensing mechanisms

    • Adaptation to fluctuating conditions

    • Coordination with electron transport processes

  • These insights connect to the broader understanding of "genome-wide gene regulation of biosynthesis and energy generation"

  • Knowledge of these regulatory mechanisms could allow researchers to optimize conditions for bioremediation or develop genetic modifications to enhance performance

Practical Applications:

  • Findings could lead to biomarkers for monitoring bioremediation progress, similar to how "molecular (mRNA) analysis of in situ rates of metal reduction from levels of expression of key respiratory genes" is proposed

  • Identified beneficial features could be targets for genetic engineering to create optimized Geobacter strains

  • Understanding species differences could inform the development of mixed Geobacter communities tailored to specific bioremediation challenges

These comparative studies align with the goals of applying "tools from Genomes-GTL" to address "DOE environmental restoration needs" .

What innovative methodologies might enhance ATP synthase research in Geobacter lovleyi?

Several innovative methodologies hold promise for advancing ATP synthase research in Geobacter lovleyi:

Advanced Structural Biology Approaches:

  • Time-resolved Cryo-EM: Capturing multiple conformational states of ATP synthase during its rotational cycle could reveal the precise molecular mechanisms of energy conversion in Geobacter lovleyi

  • Single-particle FRET: Fluorescence resonance energy transfer at the single-molecule level could monitor conformational changes in real-time

  • Correlative Light and Electron Microscopy (CLEM): Combining functional studies with structural analysis to directly link structure to function

Cutting-Edge Genetic Tools:

  • CRISPR-Cas9 Genome Editing: More precise genetic manipulation of Geobacter lovleyi to create targeted mutations in ATP synthase genes

  • Inducible Degron Systems: Allowing controlled degradation of ATP synthase components to study their function in vivo

  • Synthetic Biology Approaches: Designing modular ATP synthase variants with novel properties or regulatory mechanisms

In Situ Characterization Methods:

  • In Situ Gene Expression Analysis: Building on the approach mentioned for "molecular (mRNA) analysis of the in situ metabolic state of the microbial community via whole-genome analysis"

  • Environmental Transcriptomics: Monitoring ATP synthase gene expression directly in bioremediation field sites

  • Portable Sequencing Technologies: Enabling real-time monitoring of gene expression changes during bioremediation processes

Integrative Multi-omics:

  • Spatially Resolved Transcriptomics: Mapping ATP synthase expression patterns within biofilms

  • Proteometabolomics: Correlating ATP synthase protein levels with metabolite profiles

  • Environmental Metatranscriptomics: Studying ATP synthase expression in mixed microbial communities during bioremediation

These innovative methodologies could substantially enhance our understanding of ATP synthase function in Geobacter lovleyi, particularly in the context of its unique capabilities in "bioremediation of contaminated environments" and "electricity production from waste organic matter" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.