Recombinant Geobacter lovleyi ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance to arrange dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life is 6 months at -20°C/-80°C for liquid form and 12 months at -20°C/-80°C for lyophilized form.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
atpF; Glov_3174; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Target Names
atpF
Target Protein Sequence
MLIQNDRRMQRILSGLAVAVAILVPVLALASGGGEHHPDSGAQLKDFGWRVVDFALLAGI MIWALKKANVKGSLAERQLQIEKNLREAREARETAEAKLKEYTEKLEKANQEVDTLRAAM LKEAEAEKQRIVAEAQAAAAKVTEQAAQAADQEVLKARTELRVEAARLAVELAGGKLGAA VQKADHDRFVQDYLGKVVQL
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous F1 catalytic core and the membrane-bound F0 proton channel, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled, via a rotary mechanism involving the central stalk subunits, to proton translocation. This subunit is a component of the F0 channel, forming part of the peripheral stalk, linking F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does Geobacter lovleyi ATP synthase subunit b function within the bacterial cellular machinery?

ATP synthase subunit b (atpF) in Geobacter lovleyi serves as a critical structural and functional component of the F-type ATP synthase complex. This complex is responsible for ATP production, the universal energy currency required for cellular processes. The subunit b forms part of the F0 sector, which is embedded in the cell membrane and functions in proton translocation.

The ATP synthase operates as a rotary molecular machine, where proton flow across the membrane drives the rotation of a ring of c-subunits, which in turn drives conformational changes in the F1 sector to synthesize ATP . In Geobacter species, this ATP production is particularly important for their unique respiratory processes involving extracellular electron transfer during anaerobic respiration with metals and other electron acceptors .

What expression systems are most effective for recombinant production of Geobacter lovleyi atpF?

Based on available research, E. coli represents the most commonly used and effective expression system for recombinant production of Geobacter lovleyi ATP synthase subunit b. Specifically, full-length G. lovleyi atpF (1-200aa) with an N-terminal His tag has been successfully expressed in E. coli . This approach takes advantage of the well-established genetic tools and rapid growth characteristics of E. coli.

For optimal expression, several vector systems can be employed, including:

Vector SystemFeaturesApplication
pET-based vectorsT7 promoter, high expressionHigh-yield production
pMAL-c2xMBP fusion, increased solubilityEnhanced solubility for potentially insoluble proteins
pFLAG-MACFLAG-tag fusionImproved purification and detection

When expression difficulties are encountered due to protein toxicity or folding issues, co-expression with chaperone proteins such as DnaK, DnaJ, and GrpE using a plasmid like pOFXT7KJE3 has been shown to substantially increase yields of recombinant proteins .

What purification methods yield the highest purity and recovery for recombinant Geobacter lovleyi atpF?

The most effective purification strategy for recombinant Geobacter lovleyi atpF depends on the fusion tag utilized during expression. For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar matrices is the initial purification step of choice.

A comprehensive purification protocol typically involves:

  • Cell lysis using sonication or mechanical disruption in a buffer containing appropriate protease inhibitors

  • Clarification of lysate by centrifugation (typically 20,000×g for 30-45 minutes)

  • IMAC purification for His-tagged proteins

  • Optional: Size exclusion chromatography for further purification

  • Concentration and buffer exchange using ultrafiltration

  • Quality assessment using SDS-PAGE to confirm purity >90%

For long-term storage, the purified protein can be maintained as a lyophilized powder or in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, with addition of 5-50% glycerol (final concentration) when stored at -20°C/-80°C .

How can researchers optimize the solubility of recombinant Geobacter lovleyi atpF during expression?

Optimizing solubility of recombinant Geobacter lovleyi atpF requires attention to several experimental parameters:

  • Expression temperature modulation: Lowering the expression temperature to 16-25°C after induction can significantly improve protein folding and solubility.

  • Co-expression with chaperones: As demonstrated with other challenging proteins, co-expression of chaperone proteins such as DnaK, DnaJ, and GrpE using the pOFXT7KJE3 plasmid or similar systems can substantially enhance proper folding and solubility .

  • Fusion tag selection: Utilizing solubility-enhancing fusion partners such as maltose-binding protein (MBP) through vectors like pMAL-c2x can improve solubility of membrane-associated proteins like atpF .

  • Induction optimization: Testing various IPTG concentrations (typically 0.1-1.0 mM) and induction durations can identify conditions that balance expression level with proper folding.

  • Buffer composition: Including mild detergents (such as 0.1% Triton X-100) or specific lipids in lysis buffers can improve solubilization of this membrane-associated protein.

What methods can be used to assess the functional activity of recombinant Geobacter lovleyi atpF?

Assessing the functional activity of recombinant Geobacter lovleyi ATP synthase subunit b requires approaches that evaluate both its ability to assemble into the ATP synthase complex and the functional capability of the resulting complex:

  • Assembly assays: Monitoring the integration of recombinant atpF into ATP synthase complexes can be performed using:

    • Blue Native PAGE to visualize intact ATP synthase complexes

    • Co-immunoprecipitation experiments with antibodies against other ATP synthase subunits

    • Fluorescence resonance energy transfer (FRET) using fluorescently labeled subunits

  • ATP synthesis activity: Reconstitution of ATP synthase complexes containing recombinant atpF in liposomes, followed by measurement of ATP synthesis upon generation of a proton gradient.

  • Structural analysis: Circular dichroism (CD) spectroscopy can confirm proper secondary structure formation of the recombinant protein.

It's worth noting that validation of ATP synthesis activity is essential in functional studies, as structural data alone does not confirm functionality of the assembled complex .

How does Geobacter lovleyi atpF contribute to microbial community dynamics in subsurface environments?

Proteogenomic studies have revealed important insights into how Geobacter lovleyi and its ATP synthase components contribute to microbial community dynamics:

  • During biostimulation processes in subsurface environments, Geobacter lovleyi has been observed to increase from approximately 4% to 15% of the microbial community, indicating its ecological importance in these settings .

  • The ATP synthase components, including atpF, play critical roles in energy generation during extracellular electron transfer processes, which are fundamental to Geobacter metabolism in subsurface environments undergoing bioremediation.

  • Protein abundance profiles showed decreasing levels of ATP synthase subunits during later stages of biostimulation, suggesting metabolic adaptation through slowing cell growth in response to changing environmental conditions .

  • Proteogenomic data indicates the coexistence of multiple strain variants with distinct ATP synthase compositions, highlighting the genomic plasticity that enables Geobacter adaptation to varying environmental conditions .

This understanding of ATP synthase dynamics in Geobacter species provides valuable insights for environmental monitoring and bioremediation strategies.

How can structure-based approaches utilizing Geobacter lovleyi atpF advance drug discovery or biotechnological applications?

Structure-based approaches utilizing Geobacter lovleyi ATP synthase subunit b can advance several research areas:

  • Antimicrobial development: High-resolution structural data of ATP synthases can inform the design of ligands capable of binding to specific sites on the ATP synthase complex, potentially inhibiting its function in pathogenic microorganisms .

  • Bioenergy applications: Understanding the structural features of ATP synthase components from electrogenic bacteria like Geobacter lovleyi could inform the development of microbial fuel cells or other bioelectrochemical systems.

  • Synthetic biology: The modular nature of ATP synthase components permits engineering approaches to create hybrid enzymes with novel properties. Recombinant atpF can serve as a building block for such synthetic biology applications.

  • Nanotechnology: ATP synthase is a natural rotary molecular machine, and components like atpF are essential for its structure and function. Engineered versions could potentially serve as components in nanoscale devices.

These approaches rely on high-resolution structural data of different ATP synthase families to identify conserved features and unique characteristics that can be exploited for specific applications .

What role does Geobacter lovleyi atpF play in bacterial adaptation to different environmental conditions?

Geobacter lovleyi ATP synthase subunit b appears to play a significant role in bacterial adaptation to environmental conditions through several mechanisms:

What are the common challenges in recombinant expression of Geobacter lovleyi atpF and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant Geobacter lovleyi atpF:

  • Low expression levels: This can be addressed by:

    • Optimizing codon usage for the expression host

    • Testing different promoter systems

    • Screening multiple E. coli strains optimized for expression (BL21(DE3), T7 Express lysY/Iq, etc.)

  • Protein toxicity: ATP synthase components may exhibit toxicity to host cells, which can be mitigated by:

    • Using tightly regulated expression systems

    • Co-expression with chaperones (DnaK, DnaJ, and GrpE) using systems like pOFXT7KJE3

    • Employing host strains with enhanced tolerance to toxic proteins

  • Protein insolubility: As a membrane-associated protein, atpF may exhibit solubility issues, which can be improved by:

    • Expressing as a fusion protein with solubility-enhancing tags

    • Including mild detergents in extraction buffers

    • Optimizing buffer conditions (pH, salt concentration, additives)

  • Improper folding: Ensure correct protein folding by:

    • Lowering expression temperature (16-25°C)

    • Co-expressing with specific chaperones

    • Testing different induction conditions (IPTG concentration, induction time)

How can researchers validate the structural integrity of purified recombinant Geobacter lovleyi atpF?

Validating the structural integrity of purified recombinant Geobacter lovleyi atpF requires a multi-faceted approach:

  • SDS-PAGE analysis: Confirm the correct molecular weight and purity (>90%) of the purified protein .

  • Western blotting: Use antibodies specific to the protein or its tag to verify identity.

  • Mass spectrometry: Perform peptide mass fingerprinting to confirm the protein sequence and identify any post-translational modifications.

  • Circular dichroism (CD) spectroscopy: Assess secondary structure content and compare with predicted structural elements.

  • Size exclusion chromatography: Evaluate the oligomeric state and homogeneity of the purified protein.

  • Thermal shift assays: Determine protein stability under various buffer conditions to optimize storage.

  • Functional reconstitution: Ultimately, the ability of the recombinant atpF to integrate into functional ATP synthase complexes provides the most meaningful validation of structural integrity.

These approaches collectively provide a robust assessment of whether the recombinant protein maintains its native structural properties after purification.

What emerging technologies could enhance our understanding of Geobacter lovleyi atpF structure and function?

Several cutting-edge technologies show promise for advancing our understanding of Geobacter lovleyi ATP synthase subunit b:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized structural biology of membrane protein complexes and could provide high-resolution insights into how atpF integrates within the complete ATP synthase complex.

  • Single-molecule techniques: Methods such as single-molecule FRET and optical tweezers could reveal dynamic aspects of atpF function within the rotary mechanism of ATP synthase.

  • Native mass spectrometry: This approach would allow determination of the stoichiometry and interactions of atpF within intact ATP synthase complexes.

  • In-cell NMR: Provides structural and dynamic information about proteins within their cellular environment, potentially revealing how atpF behaves in its native context.

  • Molecular dynamics simulations: Computational approaches can model how atpF interacts with other ATP synthase components and responds to the proton-motive force.

These technologies, combined with established biochemical methods, have the potential to significantly deepen our understanding of this important component of bacterial energy metabolism.

How might synthetic biology approaches utilizing Geobacter lovleyi atpF advance bioenergy applications?

Synthetic biology approaches utilizing Geobacter lovleyi ATP synthase subunit b hold considerable promise for bioenergy applications:

  • Engineered microbial fuel cells: Modifying atpF and other ATP synthase components could potentially enhance electron transfer efficiency in Geobacter-based microbial fuel cells, improving power output.

  • ATP production systems: Engineered ATP synthase complexes containing modified atpF could potentially be incorporated into artificial systems for ATP production, providing energy for various biotechnological processes.

  • Hybrid energy conversion systems: Combining recombinant ATP synthase components with artificial light-harvesting systems could create novel bioelectronic interfaces for solar energy conversion.

  • Bioelectrochemical sensing platforms: Engineered ATP synthases could serve as sensitive detectors in bioelectrochemical sensing platforms for environmental monitoring.

  • Biomimetic energy materials: Understanding the structure-function relationships of atpF and other ATP synthase components could inspire the design of novel biomimetic materials for energy conversion and storage.

These applications leverage the natural role of ATP synthase as an efficient biological energy conversion machine, with atpF serving as a critical component in its structure and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.