Recombinant Geobacter lovleyi ATP synthase subunit c (atpE)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant atpE is manufactured via bacterial expression systems, with rigorous quality control:

ParameterDetail
Expression HostE. coli
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionDissolved in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability

Freeze-thaw cycles are avoided to prevent degradation, and working aliquots are stored at 4°C for ≤1 week .

Functional Role and Biotechnological Relevance

The atpE subunit is a core component of the F₀ sector in ATP synthase, enabling proton translocation across membranes. In Geobacter lovleyi, this enzyme supports energy conservation during organohalide respiration, such as PCE-to-cis-DCE dechlorination .

Applications in Research

  • Biochemical Assays: Used to study proton-coupled ATP synthesis and subunit interactions .

  • ELISA Development: Serves as an antigen for detecting anti-atpE antibodies or validating assay specificity .

  • Structural Studies: His-tag facilitates crystallography or cryo-EM to resolve c-ring assembly in ATP synthase .

Comparative Genomic and Functional Insights

Geobacter lovleyi diverges from other Geobacter species in its genomic adaptations for organohalide respiration. For example:

  • Genomic Islands: The pce gene cluster (encoding reductive dehalogenases) is absent in non-PCE-respiring Geobacter strains .

  • Cobalamin Biosynthesis: Plasmid pSZ77 in G. lovleyi strain SZ encodes 15/24 enzymes for cobalamin synthesis, a cofactor essential for organohalide respiration .

FeatureG. lovleyiOther Geobacter spp.
PCE RespirationEnabled by pce-genesAbsent
Cobalamin GenesPlasmid-encoded (pSZ77)Chromosomal
Cytochrome ContentReduced c-type cytochromesHigher abundance

Research Gaps and Future Directions

While the recombinant atpE is well-characterized for structural studies, its role in G. lovleyi’s unique metabolic pathways (e.g., Na⁺ vs. H⁺ transport) remains underexplored. Future work could:

  • Investigate c-ring stoichiometry (e.g., 10 vs. 14 subunits in other organisms) .

  • Develop inhibitors targeting atpE for bioremediation optimization .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpE; Glov_3143; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-91
Protein Length
full length protein
Species
Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Target Names
atpE
Target Protein Sequence
MNFFTMCMLAAGFGMAIGAFGTGIGQGLAVKSAVEGVSRNPGASGKILTTMMIGLAMIES LAIYVLVVCLIILFANPYKDVAIKALETVAK
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits.
Database Links
Protein Families
ATPase C chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.