Recombinant Geobacter lovleyi NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
nuoA; Glov_3138; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Target Names
nuoA
Target Protein Sequence
MLGTYLPIMLLILVALAFGLGSVVFSSLIGQKKFSKVKMAPYECGCEPIGTARERFPIKF YLIAMLFILFDIEAVFLYPWAVLYKKLGLFGLVEMGLFVVILFVGYIYVWKKGALEWE
Uniprot No.

Target Background

Function
NDH-1 functions as an electron shuttle, transferring electrons from NADH to quinones within the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this organism, the primary electron acceptor is believed to be a menaquinone. The enzyme couples this redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does Geobacter lovleyi nuoA contribute to the organism's metabolic functions?

G. lovleyi is notable for its diverse metabolic capabilities, including dissimilatory nitrate reduction to ammonium (DNRA), metal reduction, and tetrachloroethene (PCE) dechlorination . The NADH-quinone oxidoreductase complex, of which nuoA is a component, plays a fundamental role in these processes by participating in electron transport chains.
Methodological approach for investigating nuoA metabolic functions:

  • Generate knockouts or site-directed mutants of nuoA

  • Assess growth rates under various electron acceptor conditions (Fe(III), nitrate, PCE)

  • Measure electron transfer rates using techniques such as protein film voltammetry

  • Determine consumption threshold concentrations of electron donors (H₂, acetate)
    Studies with G. lovleyi strain SZ have shown specific threshold concentrations for different electron acceptors. With PCE, Fe(III), and nitrate as electron acceptors, H₂ was consumed to threshold concentrations of 0.08±0.03 nM, 0.16±0.07 nM, and 0.5±0.06 nM, respectively . Similar experiments can be designed to evaluate the specific contribution of nuoA to these processes.

What expression systems are most effective for producing recombinant Geobacter lovleyi nuoA?

Successful expression of recombinant G. lovleyi nuoA has been achieved using E. coli expression systems . When selecting an expression system, researchers should consider the following methodological factors:
Table 1. Optimized Expression Conditions for Recombinant G. lovleyi nuoA

ParameterRecommended ConditionNotes
Expression hostE. coli BL21(DE3)Preferred for membrane proteins
VectorpET24b or pCDNdeIIContains N-terminal His-tag for purification
Induction1 mM IPTGLower concentrations may reduce protein aggregation
Temperature20-25°C post-inductionLower temperatures improve folding
MediaNBAF supplemented with kanamycinSimilar to conditions used for other Geobacter proteins
Lysis bufferTris/PBS-based, pH 8.0Addition of detergents may be necessary
For membrane proteins like nuoA, inclusion of appropriate detergents during solubilization is critical. Researchers should evaluate multiple detergents (DDM, LDAO, etc.) to identify optimal conditions for maintaining protein structure and function after extraction from the membrane.

How can researchers design experiments to investigate nuoA's role in the electron transport chain of Geobacter lovleyi?

Investigating nuoA's specific role requires sophisticated experimental approaches that distinguish its functions from other complex components. A comprehensive methodology should include:

  • Genetic manipulation strategies:

    • Generate truncation mutants at different positions of nuoA protein

    • Employ site-directed mutagenesis of conserved residues, particularly focusing on the transmembrane domains

    • Create chimeric proteins with homologous subunits from related organisms

  • Functional assays:

    • Measure NADH-quinone oxidoreductase activity using spectrophotometric methods

    • Assess membrane potential changes using fluorescent probes

    • Determine electron transfer kinetics using stopped-flow spectroscopy

  • Structural analyses:

    • Use BN-PAGE to assess complex assembly similar to techniques used for nuoL and nuoM subunits

    • Apply crosslinking studies to map interaction networks

    • Implement cryo-electron microscopy for structural determination of the intact complex
      Researchers should pay particular attention to experimental controls, as previous studies with nuoL and nuoM have shown that seemingly contradictory data between studies "could be explained by the difference in the experimental approach" . Introduction of mutations directly to chromosomal DNA versus plasmid-based expression can yield different results.

What approaches can resolve contradictions in experimental data regarding nuoA function?

Researchers frequently encounter contradictory results when studying complex membrane proteins like nuoA. A systematic troubleshooting approach includes:

  • Examine expression system differences:

    • Compare chromosomal integration versus plasmid-based expression

    • Assess protein levels using quantitative Western blotting

    • Evaluate the impact of fusion tags on protein function

  • Validate knockout phenotypes:

    • Generate complementation strains to verify phenotypes

    • Use conditional expression systems to control protein levels

    • Implement CRISPR interference for transient knockdown studies

  • Standardize activity measurements:

    • Establish consistent buffer conditions and substrate concentrations

    • Perform enzyme kinetics under varying pH and temperature conditions

    • Include appropriate internal standards

  • Combine in vitro and in vivo approaches:

    • Reconstitute purified nuoA into liposomes for controlled studies

    • Perform in vivo metabolic labeling to track electron flow

    • Use live-cell imaging with fluorescent probes to monitor complex assembly
      When analyzing contradictory data, consider that "deletion of either NuoL or NuoM resulted in an incomplete assembly of NDH-1 and a total loss of the NADH-quinone oxidoreductase activity" . Similar effects might be observed with nuoA manipulations, necessitating careful distinction between direct functional impacts and indirect effects due to complex destabilization.

How can phylogenetic analysis of nuoA inform experimental design for functional studies?

Phylogenetic analysis provides valuable insights for designing targeted experiments. Researchers studying G. lovleyi nuoA should:

  • Perform comprehensive sequence alignment:

    • Align nuoA sequences across Geobacteraceae and related bacteria

    • Identify conserved domains and species-specific variations

    • Map conservation onto predicted structural models

  • Analyze co-evolution patterns:

    • Identify residues that co-evolve with other subunits

    • Examine correlation between evolutionary rates and functional importance

    • Compare evolutionary patterns with other respiratory complexes

  • Design targeted mutations based on evolutionary insights:

    • Focus on unique residues in G. lovleyi compared to other species

    • Target highly conserved residues for alanine scanning mutagenesis

    • Create chimeric proteins based on phylogenetic groupings
      Similar to studies on NrfA where "phylogenetic analysis revealed four separate emergences of Arg-containing NrfA enzymes" , evolutionary analysis of nuoA may reveal unique adaptations in G. lovleyi that contribute to its metabolic versatility. This information can guide the design of experiments targeting these unique features.

What technical considerations are important when integrating recombinant nuoA into functional studies of electron transport?

Functional reconstitution of membrane proteins like nuoA presents significant technical challenges. A methodological approach should consider:

  • Protein purification optimization:

    • Use mild detergents to maintain native conformation

    • Implement size-exclusion chromatography to ensure monodispersity

    • Verify protein integrity through circular dichroism spectroscopy

  • Membrane incorporation strategies:

    • Compare liposomes, nanodiscs, and polymer-based systems

    • Optimize lipid composition to mirror native G. lovleyi membranes

    • Control protein orientation during reconstitution

  • Activity assay development:

    • Establish electron donor/acceptor pairs relevant to G. lovleyi physiology

    • Implement oxygen-free techniques for anaerobic proteins

    • Develop high-throughput assays for mutational analysis

  • Integration with other complex components:

    • Co-reconstitute with interacting subunits

    • Assess stability using BN-PAGE and analytical ultracentrifugation

    • Measure subunit stoichiometry in reconstituted systems
      When working with nuoA, remember that it's part of a larger complex where "C-terminal segments of both subunits [nuoL and nuoM] play important structural roles" . Similar structural constraints likely apply to nuoA, requiring careful consideration of terminal modifications when designing constructs.

How does nuoA contribute to Geobacter lovleyi's potential in bioremediation applications?

G. lovleyi has significant bioremediation potential, particularly for sites contaminated with uranium and chlorinated compounds. Understanding nuoA's role can inform bioremediation strategies:

  • Evaluate nuoA's contribution to contaminant transformation:

    • Assess impact of nuoA mutations on PCE dechlorination rates

    • Measure U(VI) reduction capacity with altered nuoA expression

    • Determine electron transfer efficiency to various environmental contaminants

  • Optimize electron donor conditions for nuoA-dependent processes:

    • Test acetate, hydrogen, and alternative electron donors

    • Determine threshold concentrations under varying redox conditions

    • Investigate competition between electron acceptors

  • Examine environmental factors affecting nuoA function:

    • Evaluate temperature and pH dependencies

    • Assess impact of co-contaminants on activity

    • Determine oxygen tolerance thresholds
      Researchers should note that G. lovleyi strain SZ "is the only reductive bacteria identified as being capable of reducing PCE to 1,2-cis-Dichloroethene (cis-DCE) while simultaneously reducing U(VI) to sparingly soluble U(IV)" . Understanding how nuoA contributes to these processes could lead to enhanced bioremediation strategies, especially given recent findings that G. lovleyi "under substrate conditions with excess fumarate had increased dechlorination kinetics and appeared to be somewhat oxygen tolerant, despite previously being considered a strict anaerobe" .

What statistical approaches are most appropriate for analyzing nuoA mutant phenotypes?

When analyzing complex phenotypes resulting from nuoA mutations, researchers should implement:

  • Multivariate analysis techniques:

    • Principal component analysis to identify patterns in multidimensional data

    • Hierarchical clustering to group similar phenotypes

    • ANOVA with post-hoc tests for comparing multiple conditions

  • Time-series analysis methods:

    • Growth curve fitting using appropriate models (Gompertz, logistic, etc.)

    • Rate calculations at different growth phases

    • Change-point analysis to identify metabolic shifts

  • Normalization strategies:

    • Account for differences in protein expression levels

    • Normalize electron transfer rates to cell density or protein content

    • Implement internal standards for cross-experiment comparisons
      When designing experiments, follow optimal experimental design principles as outlined in recent literature , particularly regarding replication, randomization, and blocking to control for confounding variables.

How can genomic and transcriptomic approaches enhance understanding of nuoA function?

Integrating genomic and transcriptomic data provides comprehensive insights into nuoA function:

  • Comparative genomic analysis:

    • Examine nuoA gene context across Geobacter species

    • Identify regulatory elements in the promoter region

    • Look for evidence of horizontal gene transfer or gene duplication

  • Transcriptomic profiling approaches:

    • Compare gene expression profiles between wild-type and nuoA mutants

    • Assess co-expression patterns with other respiratory components

    • Identify compensatory responses to nuoA deficiency

  • Data integration strategies:

    • Correlate expression levels with enzymatic activities

    • Map transcriptional changes onto metabolic pathways

    • Develop predictive models combining genomic and expression data
      Similar approaches have been successfully applied to other Geobacter species, where "genome-wide gene regulation of biosynthesis and energy generation" studies revealed important insights into respiratory mechanisms . For G. lovleyi specifically, researchers can leverage "significant similarities in genomes of as-yet-uncultured Geobacter species and pure cultures of Geobacter species" to inform experimental design.

What emerging technologies might advance research on Geobacter lovleyi nuoA?

Several cutting-edge approaches show promise for nuoA research:

  • Cryo-electron microscopy for structural studies:

    • Determine high-resolution structures of the complete NDH-1 complex

    • Visualize conformational changes during electron transfer

    • Map nuoA interactions with neighboring subunits

  • Single-molecule techniques:

    • Measure electron transfer at the single-complex level

    • Track complex assembly in real-time

    • Assess heterogeneity in functional properties

  • CRISPR-based approaches:

    • Implement CRISPRi for tunable gene expression

    • Develop base editing techniques for precise genetic modifications

    • Create reporter fusions to monitor protein dynamics in vivo

  • Computational modeling:

    • Develop "in silico models that can predict the response of Geobacter to different environmental conditions"

    • Implement molecular dynamics simulations of nuoA within the membrane environment

    • Use machine learning to predict phenotypic outcomes of genetic modifications
      The development of these technologies will enable researchers to address currently unanswerable questions about nuoA function and contribute to broader understanding of respiratory processes in environmentally important bacteria.

How might nuoA research contribute to synthetic biology applications?

Understanding nuoA function could enable various synthetic biology applications:

  • Engineered electron transfer systems:

    • Design optimized electron transport chains for specific applications

    • Create hybrid systems combining components from different organisms

    • Develop synthetic electron bifurcation mechanisms

  • Bioremediation enhancements:

    • Engineer strains with improved contaminant reduction capabilities

    • Develop biosensors for monitoring remediation progress

    • Create robust organisms for challenging environmental conditions

  • Bioelectrochemical systems:

    • Design improved microbial fuel cells with enhanced power output

    • Develop bioelectrosynthesis platforms for chemical production

    • Create self-sustaining bioelectronic devices
      Research on G. lovleyi nuoA contributes to a growing body of knowledge that can inform "elucidating the likely outcome of genetically engineering novel metabolic capabilities in Geobacter" , with potential applications extending beyond environmental remediation to sustainable energy production and biosynthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.