Recombinant Geobacter lovleyi NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Protein Overview

nuoK (UniProt ID: B3E9V9) is a 100-amino-acid transmembrane protein encoded by the nuoK gene in G. lovleyi. It belongs to the Complex I subunit 4L family and is part of the 14-subunit NDH-1 (NADH dehydrogenase I) complex. Key features include:

  • Role: Facilitates electron transfer from NADH to ubiquinone while translocating protons across the membrane, contributing to the proton motive force (PMF) .

  • Sequence: The recombinant version includes an N-terminal 10xHis tag for affinity purification, expressed in E. coli .

  • Catalytic Activity: NADH + quinone → NAD⁺ + quinol .

PropertyDetail
Length100 amino acids (full-length)
TagN-terminal 10xHis tag
Expression HostE. coli
Subcellular LocationCell inner membrane (multi-pass transmembrane protein)

Production and Purification

The recombinant nuoK is produced via heterologous expression in E. coli. Key steps include:

  1. Cloning: The nuoK gene is cloned into a plasmid under a regulated promoter (e.g., P(BAD) in some bacterial systems) .

  2. Expression: Induced in E. coli cultures, yielding the tagged protein.

  3. Purification: Affinity chromatography using nickel columns to isolate the His-tagged protein .

  4. Storage: Maintained at -20°C or -80°C to preserve stability .

ParameterSpecification
PurityHigh (affinity-purified)
Quinone ContentVariable (depends on detergent use during solubilization)
ApplicationsBiochemical assays, structural studies, electron transfer research

Role in Complex I

In G. lovleyi, Complex I operates within the respiratory chain, enabling energy conservation. While G. lovleyi is primarily studied for organohalide respiration, nuoK’s role aligns with broader bacterial Complex I functions:

  • Electron Transport: Couples NADH oxidation to ubiquinone reduction, donating electrons to downstream respiratory complexes .

  • Proton Translocation: Translocates 4 H⁺ per 2 electrons, generating PMF for ATP synthesis .

Comparative Insights

  • Vibrio cholerae Na⁺-NQR: Unlike G. lovleyi’s proton-pumping Complex I, V. cholerae’s Na⁺-NQR translocates Na⁺ ions, highlighting divergent evolutionary adaptations in ion transport .

  • Geobacter Metabolic Flexibility: G. lovleyi’s genome encodes plasmid-borne cobalamin biosynthesis genes, which may support organohalide respiration but do not directly involve nuoK .

Experimental Uses

  1. Structural Studies: His-tagged nuoK facilitates crystallization and cryo-EM analysis to resolve subunit interactions in Complex I .

  2. Enzymatic Assays: Measuring NADH-dependent quinone reduction kinetics to study electron transfer efficiency .

  3. Comparative Genomics: Analyzing subunit conservation (e.g., fused NuoCD subunits in clade E Complex I) to infer evolutionary pressures .

Limitations

  • Functional Studies: Direct studies on G. lovleyi nuoK are sparse; most insights derive from homologous Complex I systems (e.g., E. coli, V. cholerae) .

  • Membrane Integration: Recombinant expression in E. coli may not fully replicate native membrane environments, affecting activity .

Comparative Analysis of Complex I Subunits

SubunitFunctionKey FeaturesExamples
nuoKMembrane anchor, proton translocationMulti-pass transmembrane, His-tagged G. lovleyi, E. coli
NuoCDQuinone binding, electron transferFused in clade E Complex I Sulfur-reducing bacteria
NuoENADH binding, redox centerVariable length (166–457 aa) Rhodobacter capsulatus

Future Directions

  1. Structural Elucidation: Resolving nuoK’s role in proton channel formation using cryo-EM.

  2. Metabolic Integration: Investigating how nuoK interacts with G. lovleyi’s organohalide respiration pathways.

  3. Biotechnological Applications: Leveraging nuoK for biofuel production or bioremediation via engineered electron transfer systems.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format we currently have in stock, we are happy to accommodate specific format requests. Please include your preferred format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard protocol uses a final glycerol concentration of 50%, which you may use as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Glov_3128; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Target Names
nuoK
Target Protein Sequence
MDNLSNYLIVSAVLFSIGTIGVLTRKNAIVVFMCIELMLNAVNLTFVAFSRHLGNLDGQI FVFFIMTVAAAEAAVGLALFIAFFNNRESIDIDDANLMKW
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction to proton translocation, transferring four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process effectively conserves redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its function in Geobacter lovleyi?

NADH-quinone oxidoreductase subunit K (nuoK) is an integral membrane component of the NADH dehydrogenase I complex (NDH-1) in Geobacter lovleyi. This protein functions as part of the respiratory chain, catalyzing the transfer of electrons from NADH to quinones (EC 1.6.99.5). The nuoK protein is encoded by the nuoK gene (Glov_3128) in G. lovleyi and plays a crucial role in energy conservation through respiration. As a membrane-embedded subunit, nuoK is involved in proton translocation across the cell membrane, contributing to the generation of proton motive force used for ATP synthesis .

How does G. lovleyi nuoK compare with homologous subunits in other bacterial species?

G. lovleyi nuoK shares structural and functional similarities with homologous subunits in other bacterial species, particularly within the complex I (NADH:quinone oxidoreductase) of the electron transport chain. While specific sequence homology varies between species, the functional domains remain largely conserved. Unlike the Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) from Vibrio cholerae that functions as a sodium pump, the G. lovleyi complex likely functions as a proton pump, similar to most bacterial type I NADH dehydrogenases . Comparisons with other Geobacter species show high conservation of functional domains, particularly in regions associated with proton translocation and inter-subunit interactions within the NADH dehydrogenase complex .

What expression systems are optimal for producing recombinant G. lovleyi nuoK?

For optimal expression of recombinant G. lovleyi nuoK, E. coli-based expression systems have been successfully employed, similar to the approach used for the nuoA subunit from the same organism . Since nuoK is a membrane protein with multiple transmembrane domains, specialized expression systems designed for membrane proteins are recommended. These include:

  • E. coli strains optimized for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3))

  • Expression vectors with tunable promoters (such as the arabinose-inducible PBAD system used for V. cholerae Na+-NQR)

  • Fusion tag systems that enhance membrane protein folding and stability

Expression conditions should be carefully optimized, typically employing lower induction temperatures (16-25°C) and reduced inducer concentrations to prevent formation of inclusion bodies and promote proper membrane insertion .

What are the most effective purification strategies for G. lovleyi nuoK?

Purification of recombinant G. lovleyi nuoK requires specialized approaches due to its membrane-associated nature. The most effective strategies include:

  • Affinity chromatography using a histidine tag system, similar to that employed for the nuoA subunit

  • Membrane solubilization using appropriate detergents, with dodecyl maltoside (DM) being preferred over LDAO based on experiences with similar proteins

  • Size exclusion chromatography as a polishing step to obtain highly pure protein

The purification protocol should incorporate:

  • Careful membrane fraction isolation using ultracentrifugation

  • Membrane solubilization with gentle detergents (1-2% DM or similar)

  • Affinity purification under optimized buffer conditions containing detergents at concentrations above their critical micelle concentration

  • Elution with an imidazole gradient for His-tagged constructs

  • Buffer exchange to remove imidazole while maintaining detergent concentration

How can researchers overcome challenges associated with expressing and purifying membrane proteins like nuoK?

Expressing and purifying membrane proteins like nuoK presents several challenges that can be addressed through these methodological approaches:

  • Toxicity issues: Employ tightly regulated expression systems and C41/C43 E. coli strains specifically designed for toxic membrane proteins

  • Protein aggregation: Lower induction temperature (16-20°C), reduce inducer concentration, and consider co-expression with chaperones

  • Low yield: Scale up culture volumes and optimize media composition with supplements like glycerol and specific metal ions

  • Improper folding: Include proper cofactors in growth media and consider homologous expression in Geobacter species as demonstrated for the V. cholerae Na+-NQR system

  • Detergent selection: Screen multiple detergents; dodecyl maltoside has shown success with similar proteins while LDAO may result in loss of bound quinones

  • Protein stability: Incorporate glycerol (typically 10-20%) in all buffers and store at appropriate temperatures (-20°C/-80°C) with an optimal detergent concentration

What spectroscopic methods are most informative for analyzing G. lovleyi nuoK structure and function?

For comprehensive structural and functional characterization of G. lovleyi nuoK, multiple spectroscopic approaches should be employed:

  • UV-visible spectroscopy: Useful for monitoring redox transitions and identifying cofactors, particularly if nuoK interacts with flavins or iron-sulfur centers as seen in other NADH dehydrogenase complexes

  • Circular dichroism (CD) spectroscopy: Essential for determining secondary structure composition (α-helical content) and thermal stability of the purified protein

  • Fourier-transform infrared spectroscopy (FTIR): Provides information about protein secondary structure in membrane environments

  • Electron paramagnetic resonance (EPR): Critical for detecting and characterizing any iron-sulfur clusters or semiquinone intermediates that might interact with nuoK, similar to analysis done for related complexes

  • Nuclear magnetic resonance (NMR): For detailed structural information of specific domains, particularly when isotope-labeled protein is available

  • Mass spectrometry: For accurate molecular weight determination, post-translational modifications, and protein-ligand interactions

When applying these methods, it's essential to maintain the protein in appropriate detergent micelles or reconstituted proteoliposomes to preserve native structure .

How can researchers assess the catalytic activity of nuoK within the NADH dehydrogenase complex?

Assessment of nuoK catalytic activity within the NADH dehydrogenase complex requires specific approaches that account for its role in the larger enzyme complex:

  • Reconstitution assays: Recombinant nuoK should be reconstituted with other subunits of the NADH dehydrogenase complex to form a functional unit, similar to the approach used for V. cholerae Na+-NQR

  • NADH oxidation assays: Measure NADH consumption spectrophotometrically at 340 nm, comparing activities with and without quinone electron acceptors

  • Artificial electron acceptor assays: Use artificial electron acceptors like ferricyanide or dichlorophenolindophenol (DCPIP) to assess electron transfer capability

  • Proton translocation measurements: Employ pH-sensitive fluorescent probes or pH electrodes to monitor proton pumping activity in reconstituted proteoliposomes

  • Membrane potential measurements: Use voltage-sensitive dyes to measure the generation of membrane potential (ΔΨ) during enzyme activity

  • Oxygen consumption assays: Monitor oxygen consumption rates using a Clark-type electrode to assess terminal electron transfer to oxygen, though this reaction may be relatively slow (10-20 s-1) based on similar systems

  • Site-directed mutagenesis: Create specific mutations in conserved residues to correlate structure with function

For accurate activity measurements, it's critical to maintain appropriate sodium ion concentrations in assay buffers, as sodium may stimulate activity as observed in similar enzymes .

What methods can be used to investigate nuoK's role in proton/sodium translocation?

To investigate nuoK's role in proton/sodium translocation, researchers should employ these specialized techniques:

  • Proteoliposome reconstitution: Incorporate purified nuoK (preferably with other complex I subunits) into liposomes to create a system capable of generating ion gradients

  • Ion flux measurements: Use radioactive isotopes (22Na+ or 45Ca2+) or ion-selective electrodes to directly measure ion movement across membranes

  • Fluorescent probe assays: Employ pH-sensitive (ACMA, pyranine) or sodium-sensitive (SBFI) fluorescent probes entrapped in proteoliposomes to monitor ion movements

  • Electrophysiological approaches: Utilize planar lipid bilayer or patch-clamp techniques for direct measurement of ion currents

  • Site-directed mutagenesis: Systematically mutate conserved residues potentially involved in ion channels or proton paths to identify crucial amino acids

  • Inhibitor studies: Apply specific inhibitors of complex I (rotenone, piericidin A) or ion transporters to dissect the mechanism

  • Isotope exchange studies: Use deuterium oxide (D2O) in place of H2O to identify kinetic isotope effects indicative of proton-coupled electron transfer

These approaches, when combined with structural data, can provide a comprehensive understanding of nuoK's specific role in the ion translocation process within the respiratory complex .

How does G. lovleyi nuoK contribute to understanding bacterial respiration and energy conservation?

G. lovleyi nuoK serves as an important model for understanding fundamental aspects of bacterial respiration and energy conservation through several key contributions:

  • Respiratory diversity: Analysis of nuoK within the context of G. lovleyi's respiratory versatility helps elucidate how bacteria adapt their electron transport chains to diverse environmental conditions. G. lovleyi can utilize various electron donors and acceptors, including acetate and hydrogen as donors, and PCE and TCE as acceptors, highlighting metabolic flexibility in energy conservation .

  • Evolution of respiratory complexes: Comparative analysis of nuoK across different bacterial species provides insights into the evolution of respiratory complexes and their adaptation to specific environmental niches.

  • Membrane protein assembly: Studying nuoK incorporation into the larger NADH dehydrogenase complex improves understanding of how complex membrane protein assemblies form and function.

  • Bioenergetic mechanisms: Investigation of nuoK's role in the proton-pumping machinery enhances knowledge of the molecular mechanisms underlying the conversion of redox energy into transmembrane ion gradients.

  • Respiratory chain regulation: Analysis of nuoK expression and activity under different growth conditions helps elucidate how bacteria regulate their respiratory chains in response to environmental changes.

Understanding these fundamental aspects of bacterial bioenergetics through nuoK research contributes to broader knowledge of microbial physiology and adaptation mechanisms .

What role might nuoK play in bioremediation applications utilizing Geobacter species?

NuoK, as a component of the respiratory chain in G. lovleyi, potentially plays significant roles in bioremediation applications through several mechanisms:

  • Energy conservation during contaminant metabolism: As part of the NADH dehydrogenase complex, nuoK contributes to energy conservation during the oxidation of electron donors (like acetate or hydrogen) coupled to the reduction of contaminants (PCE, TCE) or metals, enabling G. lovleyi to derive energy for growth during bioremediation processes .

  • Adaptation to contaminated environments: Understanding nuoK function helps explain how Geobacter species adapt their respiratory chains to function efficiently in contaminated subsurface environments with limited electron donors.

  • Electron donor utilization efficiency: The NADH dehydrogenase complex containing nuoK likely contributes to G. lovleyi's ability to consume electron donors to very low threshold concentrations (acetate threshold of 3 nM), maximizing contaminant degradation in nutrient-limited environments .

  • Metal reduction coupling: The respiratory chain containing nuoK may facilitate coupled reactions where chlorinated compound reduction is linked to metal reduction, addressing mixed contamination scenarios.

  • Biomarker development: Knowledge of nuoK sequence and expression patterns could lead to the development of biomarkers for monitoring active bioremediation processes in environmental samples.

These potential roles make nuoK an important target for research aimed at enhancing bioremediation technologies using Geobacter species .

How can structural information about nuoK inform the development of inhibitors or enhancers of bacterial respiration?

Structural information about nuoK can inform drug development strategies targeting bacterial respiration through several approaches:

  • Structure-based inhibitor design: Detailed structural characterization of nuoK can reveal unique binding pockets or catalytic sites that can be targeted by small-molecule inhibitors, potentially leading to new antibacterial compounds that specifically disrupt respiratory function.

  • Identification of species-specific features: Comparative structural analysis of nuoK across different bacterial species can highlight unique structural features that could be exploited for developing species-selective inhibitors, reducing broad-spectrum effects.

  • Rational enhancement of respiratory function: For bioremediation applications, structural understanding of nuoK could guide protein engineering efforts to enhance respiratory efficiency or substrate range in Geobacter species.

  • Cofactor binding site targeting: Identification of quinone binding sites or interaction surfaces with other subunits can inform the design of molecules that competitively inhibit these interactions.

  • Allosteric regulation sites: Structural studies may reveal allosteric sites that, when targeted, could modulate respiratory chain activity without completely inhibiting it.

  • Membrane interaction interfaces: Understanding how nuoK integrates into the membrane could lead to the development of compounds that disrupt proper membrane insertion or stability.

These structure-informed approaches could lead to novel antimicrobials or bioremediation-enhancing technologies by specifically targeting or modifying respiratory chain function .

What are the most effective strategies for reconstituting nuoK into proteoliposomes for functional studies?

Reconstituting nuoK into proteoliposomes for functional studies requires careful attention to several critical parameters:

  • Lipid composition optimization:

    • Use a mixture of E. coli polar lipids or synthetic phospholipids (POPC/POPE/POPG) at ratios mimicking bacterial membranes

    • Include cardiolipin (5-10%) to support proper complex assembly and function

    • Adjust lipid composition based on G. lovleyi membrane analysis if available

  • Reconstitution methods:

    • Detergent-mediated reconstitution using controlled detergent removal via:

      • Bio-Beads SM-2 or Amberlite XAD-2 adsorption (preferred for gentle removal)

      • Dialysis against detergent-free buffer (for gradual removal)

      • Dilution below critical micelle concentration (for specific detergents)

    • Direct incorporation during liposome formation for specific applications

  • Protein:lipid ratio optimization:

    • Test multiple protein:lipid ratios (typically 1:50 to 1:200 w/w)

    • Determine optimal ratio empirically based on protein activity and stability

  • Buffer composition considerations:

    • Include physiologically relevant ion concentrations (particularly Na+ if sodium-dependent)

    • Maintain pH within functional range (typically pH 7.0-8.0)

    • Add stabilizing agents like glycerol (5-10%)

    • Include appropriate quinones (ubiquinone or menaquinone) if studying complete electron transfer

  • Verification of reconstitution:

    • Freeze-fracture electron microscopy to visualize protein incorporation

    • Sucrose density gradient centrifugation to separate proteoliposomes from free protein

    • Activity assays comparing detergent-solubilized and reconstituted protein

This methodical approach ensures functional reconstitution for downstream biophysical and biochemical analyses .

How can researchers differentiate nuoK's specific function from other subunits within the NADH dehydrogenase complex?

Differentiating nuoK's specific function from other subunits within the NADH dehydrogenase complex requires sophisticated approaches that isolate its contribution:

  • Subunit-deletion complementation studies:

    • Generate a nuoK-deletion strain of G. lovleyi or a model organism

    • Complement with wild-type or mutated nuoK variants

    • Analyze respiratory function and complex assembly to identify nuoK-specific effects

  • Cross-linking and interaction studies:

    • Apply chemical cross-linking coupled with mass spectrometry to identify direct interaction partners of nuoK

    • Use proximity labeling methods (BioID, APEX) to identify the spatial environment of nuoK

    • Analyze co-purification patterns with various detergents to identify stable subcomplexes

  • Chimeric protein analysis:

    • Create chimeric proteins by swapping domains between nuoK and homologous subunits from other species

    • Identify which domains contribute to specific functions through activity assays

  • Cryo-EM or structural analysis:

    • Obtain structural information of the complete complex with and without nuoK

    • Identify conformational changes dependent on nuoK presence

  • Single molecule studies:

    • Apply fluorescence resonance energy transfer (FRET) to study conformational changes during electron transfer

    • Use single-molecule force spectroscopy to study nuoK's contribution to complex stability

  • In silico approaches:

    • Molecular dynamics simulations to predict and analyze nuoK-specific motions or interactions

    • Bioinformatic analysis of co-evolution patterns to identify functional coupling between subunits

These approaches collectively provide insights into nuoK's specific role while accounting for its function within the larger complex .

What are the critical factors affecting the stability and activity of recombinant nuoK protein in experimental settings?

Multiple critical factors affect the stability and activity of recombinant nuoK protein in experimental settings:

  • Detergent considerations:

    • Type: Dodecyl maltoside (DM) maintains activity and preserves bound quinones, while LDAO may result in quinone loss

    • Concentration: Must be maintained above critical micelle concentration to prevent aggregation

    • Purity: Ultra-pure detergent grades prevent destabilization by contaminants

  • Buffer composition:

    • pH stability range: Typically pH 7.0-8.0 for optimal stability

    • Ionic strength: 100-300 mM sodium or potassium salts provide optimal stability

    • Glycerol content: 10-50% glycerol significantly enhances stability during storage

    • Reducing agents: Addition of mild reducing agents (1-5 mM DTT or 2-ME) prevents oxidative damage

  • Temperature management:

    • Storage temperature: -20°C for short-term, -80°C for long-term storage

    • Freeze-thaw cycles: Should be strictly minimized; aliquoting recommended

    • Working temperature: Maintain at 4°C during experiments when possible

  • Cofactor requirements:

    • Quinone content: Maintain native quinones or supplement with appropriate quinones

    • Metal ions: Include physiologically relevant concentrations of necessary metal ions

  • Lipid environment:

    • Addition of lipids: Small amounts of phospholipids (0.1-0.5 mg/ml) can stabilize membrane proteins in detergent solutions

    • Reconstitution: Full activity may require reconstitution into a lipid bilayer environment

  • Protein concentration effects:

    • Dilution: Protein stability often decreases at low concentrations

    • Concentration: Excessive concentration may lead to aggregation

  • Time-dependent degradation:

    • Proteolysis: Addition of protease inhibitors in all buffers

    • Oxidation: Storage under nitrogen or argon atmosphere for sensitive preparations

    • Activity loss: Regular activity assays to monitor functional stability

Understanding and controlling these factors is essential for maintaining nuoK in a functional state for experimental studies .

How does G. lovleyi nuoK compare structurally and functionally with homologous proteins in the respiratory chains of other bacteria?

G. lovleyi nuoK represents an important component for comparative analysis across bacterial species, revealing both conserved features and unique adaptations:

These comparative insights contribute to understanding the evolution of respiratory mechanisms across diverse bacterial lineages .

What insights can genomic context analysis provide about the evolution and function of nuoK in G. lovleyi?

Genomic context analysis of nuoK in G. lovleyi provides valuable insights into its evolution, regulation, and functional integration:

  • Operon structure and organization:

    • The nuoK gene (Glov_3128) is part of the larger nuo operon encoding the entire NADH dehydrogenase complex

    • Gene order conservation within the operon compared to other bacteria reflects evolutionary constraints on assembly processes

    • Analysis of intergenic regions may reveal regulatory elements controlling expression

  • Co-evolution patterns:

    • Correlation of evolutionary rates between nuoK and other complex I subunits indicates functional interdependence

    • Comparison with dechlorinating Geobacter species can reveal adaptations associated with this specialized metabolism

    • Analysis of selection pressures on different regions of nuoK indicates functionally critical domains

  • Horizontal gene transfer assessment:

    • G+C content analysis (56.7% for G. lovleyi) and codon usage patterns of nuoK compared to the genome average

    • Phylogenetic incongruence between nuoK and species phylogeny may indicate horizontal acquisition events

    • Presence of mobile genetic elements near the nuo operon would suggest potential transfer mechanisms

  • Comparative genomics with related species:

    • G. lovleyi's relationship to G. thiogenes, its closest relative , allows for comparative analysis of respiratory complex adaptations

    • Identification of G. lovleyi-specific sequence features in nuoK that might relate to its unique metabolic capabilities

    • Correlation of nuoK sequence variants with metabolic capabilities across Geobacter species

  • Regulatory network integration:

    • Identification of transcription factor binding sites in the promoter region of the nuo operon

    • Integration with global regulatory networks responding to electron acceptor availability

    • Correlation with expression patterns of genes involved in chlorinated compound reduction

These genomic context analyses contribute to understanding how nuoK functions within the broader metabolic network of G. lovleyi and its evolutionary history .

How do post-translational modifications affect nuoK function, and what methods are best for their characterization?

Post-translational modifications (PTMs) of nuoK likely play important roles in regulating its function, assembly, and interactions:

  • Predicted PTMs in bacterial respiratory proteins:

    • Phosphorylation of serine, threonine, or tyrosine residues affecting protein-protein interactions

    • Oxidative modifications affecting redox-active residues

    • N-terminal processing during membrane insertion

    • Potential disulfide bond formation involving conserved cysteine residues

    • Lipid modifications enhancing membrane association

  • Functional impacts of PTMs:

    • Regulation of protein-protein interactions within the complex

    • Modulation of proton translocation efficiency

    • Control of protein stability and turnover

    • Adaptation to changing environmental conditions

    • Assembly control during complex formation

  • Methodological approaches for PTM characterization:

    • Mass spectrometry-based strategies:

      • Bottom-up proteomics with enrichment steps for specific PTMs

      • Top-down proteomics for intact protein analysis

      • Targeted approaches for specific modification sites

      • Quantitative methods to assess PTM stoichiometry

    • Site-directed mutagenesis:

      • Mutation of potentially modified residues to non-modifiable variants

      • Phosphomimetic mutations (S/T→D/E) to simulate constitutive phosphorylation

    • Specific labeling approaches:

      • Pro-Q Diamond staining for phosphoprotein detection

      • Click chemistry for detection of specific modifications

      • Antibody-based detection of common PTMs

    • Functional correlation studies:

      • Activity assays under conditions that alter PTM patterns

      • Structural studies comparing modified and unmodified proteins

      • Time-course studies correlating PTM appearance with functional changes

  • Experimental challenges and solutions:

    • Low abundance of modified protein: Use enrichment strategies

    • Labile modifications: Apply gentle sample handling procedures

    • Detergent interference: Optimize MS-compatible detergents or removal strategies

    • Membrane protein challenges: Develop specialized protocols for membrane protein PTM analysis

Understanding the PTM landscape of nuoK provides insights into regulatory mechanisms controlling respiratory complex function in G. lovleyi .

What statistical approaches are most appropriate for analyzing enzyme kinetic data from studies of nuoK-containing complexes?

Proper statistical analysis of enzyme kinetic data from nuoK-containing complexes requires specialized approaches to address the complexity of membrane protein systems:

  • Enzyme kinetics model selection:

    • Standard Michaelis-Menten kinetics for simple substrate-enzyme relationships

    • Hill equation analysis for systems showing cooperativity

    • Multi-substrate kinetic models (ping-pong or sequential) for complex electron transfer chains

    • Competitive, uncompetitive, or mixed inhibition models when studying inhibitor effects

  • Statistical methods for parameter estimation:

    • Non-linear regression using least squares or maximum likelihood methods

    • Weighted regression approaches to account for heteroscedasticity in enzymatic assays

    • Bayesian parameter estimation for complex models with prior knowledge incorporation

    • Bootstrap or jackknife resampling for robust confidence interval estimation

  • Validation and model comparison:

    • Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC) for model selection

    • Residual analysis to verify model assumptions

    • Cross-validation approaches to test predictive performance

    • F-tests for nested model comparison

  • Handling variability in membrane protein systems:

    • Mixed-effects models to account for batch-to-batch variation in protein preparations

    • Propagation of error analysis for derived parameters

    • Transformation approaches for stabilizing variance

    • Analysis of covariance (ANCOVA) to adjust for covariates like lipid composition

  • Software recommendations:

    • GraphPad Prism for standard enzyme kinetics

    • R with specialized packages (drc, nlme) for advanced statistical modeling

    • Python with scipy.optimize and statsmodels for customized analysis pipelines

    • Stan or BUGS for Bayesian modeling approaches

  • Data presentation guidelines:

    • Always report both estimates and measures of uncertainty (standard errors, confidence intervals)

    • Include sample sizes and technical/biological replication information

    • Present residual plots alongside fits to demonstrate appropriateness of models

    • Use consistent units and normalization approaches when comparing across experiments

These statistical approaches ensure robust interpretation of complex kinetic data from nuoK-containing respiratory complexes .

How should researchers interpret conflicting experimental results regarding nuoK function or structure?

When faced with conflicting experimental results regarding nuoK function or structure, researchers should employ a systematic interpretive framework:

  • Methodological reconciliation approach:

    • Examine experimental conditions: Differences in buffer composition, detergent choice, or protein preparation methods may explain discrepancies

    • Evaluate protein integrity: Variations in protein stability or post-translational modifications across preparations

    • Compare detection limits: Different analytical methods have varying sensitivities and specificities

    • Assess time-dependent phenomena: Some processes may be transient or dependent on the time scale of measurement

  • Biological context considerations:

    • Strain-specific variations: Minor genetic differences between laboratory strains may explain functional differences

    • Growth condition effects: Pre-adaptation to different electron donors or acceptors may alter respiratory complex composition

    • Interaction with other cellular components: Present in some experimental setups but absent in others

    • Natural protein heterogeneity: Different conformational states or assembly intermediates may coexist

  • Integration strategies for conflicting data:

    • Hierarchical evaluation: Prioritize results from methods with higher resolution or more direct measurement approaches

    • Weight of evidence approach: Consider the preponderance of evidence across multiple studies

    • Construct testable models: Develop hypotheses that could explain seemingly contradictory results

    • Meta-analysis techniques: When sufficient studies exist, apply formal meta-analysis methods

  • Design of discriminatory experiments:

    • Identify critical experiments that could definitively resolve conflicts

    • Employ orthogonal methods to address the same question

    • Collaborate across laboratories to standardize protocols

    • Consider in vivo validation of in vitro findings

  • Reporting recommendations:

    • Transparently acknowledge conflicting results in publications

    • Discuss potential sources of discrepancies

    • Avoid selective citation that reinforces only one interpretation

    • Clearly state the limitations of current understanding

This systematic approach transforms conflicting results from obstacles into opportunities for deeper mechanistic insights into nuoK function .

What are the best practices for integrating structural, functional, and evolutionary data to develop comprehensive models of nuoK's role?

Developing comprehensive models of nuoK's role requires integration of multiple data types through these best practices:

  • Multi-scale data integration framework:

    • Atomic level: Integrate protein structure data with molecular dynamics simulations

    • Protein level: Combine functional assays with protein-protein interaction networks

    • Cellular level: Connect enzyme kinetics with cellular bioenergetics models

    • Ecological level: Relate molecular mechanisms to environmental adaptation

  • Methodological integration approaches:

    • Sequential refinement: Begin with homology models based on related structures, refine with experimental constraints

    • Bayesian integration: Update model probabilities as new data becomes available

    • Constraint-based modeling: Define the solution space using constraints from multiple experimental sources

    • Ensemble approaches: Generate multiple models consistent with available data to represent uncertainty

  • Computational tools for integration:

    • Integrative modeling platforms: Use specialized software (IMP, HADDOCK) that can incorporate diverse data types

    • Network analysis tools: Connect protein function to broader metabolic or protein interaction networks

    • Phylogenetic analysis software: Map functional variations onto evolutionary trees

    • Machine learning approaches: Identify patterns across diverse datasets that may not be apparent through traditional analysis

  • Visualization and communication strategies:

    • Develop multi-layer visualizations that simultaneously display structural, functional, and evolutionary data

    • Create interactive models that allow exploration of different data types

    • Present alternative models when data is insufficient to determine a unique solution

    • Clearly distinguish experimental data from computational predictions

  • Validation approaches:

    • Cross-validation by partitioning data into training and validation sets

    • Experimental testing of model-derived predictions

    • Sensitivity analysis to identify which model components are most critical

    • Comparison with independent datasets not used in model development

  • Community engagement:

    • Deposit models and data in public repositories with clear documentation

    • Engage with structural biologists, biochemists, and evolutionary biologists for critical evaluation

    • Develop community standards for model quality assessment

    • Update models as new experimental techniques provide additional constraints

This integrated approach leads to mechanistic models of nuoK function that synthesize structural insights, functional measurements, and evolutionary context into a coherent framework .

What are the most promising future research directions for understanding nuoK's role in bacterial bioenergetics?

Several promising research directions will advance understanding of nuoK's role in bacterial bioenergetics:

These research directions will provide deeper understanding of nuoK's fundamental role while developing practical applications in bioremediation, synthetic biology, and environmental monitoring .

How might understanding nuoK contribute to broader knowledge of bacterial adaptation to extreme environments?

Understanding nuoK contributes to knowledge of bacterial adaptation to extreme environments through several key perspectives:

  • Energetic efficiency adaptations:

    • Analysis of nuoK variants across Geobacter species reveals adaptations for energy conservation in nutrient-limited environments

    • G. lovleyi's ability to consume electron donors to exceptionally low thresholds (acetate threshold of 3 nM) demonstrates remarkable efficiency

    • Comparison of respiratory complex composition in extremophiles vs. neutrophiles highlights adaptive strategies

  • Contaminant resistance mechanisms:

    • nuoK's role in the respiratory chain supporting growth with chlorinated compounds as electron acceptors

    • Adaptations in respiratory complexes that allow function in the presence of toxic metals or organic pollutants

    • Energy conservation strategies enabling survival in heavily contaminated environments

  • Redox adaptation strategies:

    • Modifications to respiratory chains allowing function across diverse redox potentials

    • Integration of nuoK function with unique electron acceptors like metals or chlorinated compounds

    • Adjustments to proton/sodium pumping efficiency based on environmental pH or salt conditions

  • Temperature and pressure adaptations:

    • Structural modifications in nuoK from psychrophiles or thermophiles reflecting membrane fluidity adaptations

    • Pressure effects on respiratory complex assembly and function in deep subsurface microorganisms

    • Cold adaptation strategies in respiratory complexes from psychrophilic bacteria

  • Evolutionary perspectives:

    • Identification of a distinct dechlorinating clade within the metal-reducing Geobacter group based on 16S rRNA gene sequences

    • Horizontal gene transfer patterns related to respiratory adaptation

    • Convergent evolution of similar respiratory adaptations across phylogenetically distant extremophiles

These insights from nuoK research contribute to fundamental understanding of how bacteria adapt core bioenergetic processes to thrive in environments once considered uninhabitable .

What are the key unanswered questions about G. lovleyi nuoK that merit further investigation?

Despite progress in understanding G. lovleyi nuoK, several key questions remain unanswered and merit further investigation:

  • Structural mysteries:

    • What is the high-resolution structure of G. lovleyi nuoK within the complete NADH dehydrogenase complex?

    • How does the structure change during the catalytic cycle?

    • What specific interactions occur between nuoK and other subunits of the complex?

  • Functional uncertainties:

    • What is the precise role of nuoK in proton translocation versus structural support?

    • How does nuoK contribute to the remarkable electron donor utilization efficiency observed in G. lovleyi?

    • Are there alternate functions of nuoK under different growth conditions?

  • Regulatory questions:

    • How is nuoK expression regulated in response to environmental conditions?

    • What post-translational modifications occur on nuoK and how do they affect function?

    • How is assembly of nuoK into the complete complex controlled?

  • Ecological relevance:

    • How do natural variations in nuoK sequence correlate with habitat-specific adaptations?

    • What is the relationship between nuoK function and G. lovleyi's ability to reduce chlorinated compounds?

    • How does nuoK contribute to Geobacter's competitive fitness in contaminated environments?

  • Biotechnological potential:

    • Can nuoK be engineered to enhance bioremediation capabilities?

    • Is nuoK a suitable target for developing inhibitors against related pathogenic bacteria?

    • Can understanding nuoK lead to improved bioelectrochemical systems?

  • Evolutionary aspects:

    • What was the evolutionary path leading to the distinct dechlorinating clade within the Geobacter group?

    • How ancient is the current form of nuoK, and what were its ancestral functions?

    • What selective pressures shaped the current structure and function of nuoK?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.