Recombinant Geobacter lovleyi Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

Undecaprenyl-diphosphatase (uppP) is critical in the lipid cycle of peptidoglycan synthesis. It regenerates the lipid carrier undecaprenyl phosphate by cleaving the pyrophosphate group from undecaprenyl diphosphate, enabling repeated use in cell wall polymer transport . In Geobacter lovleyi, this enzyme may also intersect with metal reduction pathways, given the organism's respiratory versatility in anaerobic environments .

Recombinant Production and Characteristics

While no direct data exists for Geobacter lovleyi recombinant uppP, analogous systems (e.g., Azospirillum brasilense, Thermotoga maritima) provide technical frameworks:

PropertyExample from Azospirillum brasilense Example from Thermotoga maritima
Host SystemE. coliE. coli
TagN-terminal HisN-terminal His
Protein Length187 amino acids (Full-length)237 amino acids (Full-length)
Purity>90% (SDS-PAGE)Not specified
Storage-20°C/-80°C in Tris/PBS buffer with 6% TrehaloseSimilar lyophilized protocols likely applicable
ApplicationsSDS-PAGE analysisStructural/functional studies

Research Gaps and Opportunities

  • Sequence Data: The Geobacter lovleyi uppP amino acid sequence remains uncharacterized in public databases, unlike homologs (e.g., A. brasilense: P39438 ).

  • Functional Studies: Heterologous expression systems (e.g., E. coli) could enable biochemical characterization, leveraging protocols from analogous uppP proteins .

  • Biotechnological Potential: Given G. lovleyi’s role in bioremediation, recombinant uppP might facilitate studies on cell envelope dynamics under stress conditions .

Technical Considerations for Recombinant Production

Lessons from related systems suggest:

  • Cloning Strategies: Use codon-optimized constructs for E. coli expression .

  • Purification: Immobilized metal affinity chromatography (IMAC) for His-tagged proteins .

  • Stability: Lyophilization with trehalose or glycerol improves long-term storage .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; Glov_0524; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Target Names
uppP
Target Protein Sequence
MDLLHAALLGLIQGATEVLPISSSGHLILIPRLLGWPDSGLTFDVALHFGTFLAIFVYFR KDVVSLVQDGLTGFFQPEAPRRLRLPWMIVLASIPAAIAGKTLEQPIEELFRSSPLMIAL MLILFGLGLGLTDRYGKKLHDVASITLGTAMLVGCFQCLALVPGVSRSGITITAGLLLGL ARTDAARFSFLLSLPIVFGAALLKGLHLLKHGIEPGMAMPMLVGVAVSAVVGYISVAFLL KFVQSRTLWPFVWYRVAAGIGVMALLGVGLLS
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Undecaprenyl-diphosphatase (uppP) in Geobacter lovleyi?

Undecaprenyl-diphosphatase (uppP) in Geobacter lovleyi primarily catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) . This enzymatic activity plays a crucial role in bacterial cell wall biosynthesis by recycling the lipid carrier involved in peptidoglycan synthesis. Additionally, uppP confers resistance to the antibiotic bacitracin, which functions by binding to undecaprenyl pyrophosphate and preventing its dephosphorylation . Similar to uppP proteins in other bacterial species such as Enterococcus faecalis, G. lovleyi uppP is likely constitutively expressed and not induced by exposure to bacitracin or other cell wall-active antimicrobials .

Where is uppP located within bacterial cells?

Undecaprenyl-diphosphatase (uppP) is localized to the cell inner membrane and functions as a multi-pass membrane protein . In E. faecalis, which has a UppP protein with high sequence identity to the Escherichia coli BacA-type UppP, the protein is predicted to be hydrophobic with eight transmembrane helices . Given the structural similarities between bacterial uppP proteins, G. lovleyi uppP likely shares this transmembrane configuration, allowing it to access its substrate undecaprenyl diphosphate within the membrane environment.

How does Geobacter lovleyi differ from other Geobacter species?

Geobacter lovleyi strain SZ has several distinctive characteristics that differentiate it from other Geobacter species. It is the first member of the metal-reducing Geobacter group capable of using tetrachloroethene (PCE) as a growth-supporting electron acceptor . Additionally, G. lovleyi can reduce hexavalent uranium, U(VI), to U(IV) . What makes G. lovleyi particularly interesting for bioremediation applications is its ability to reduce PCE and U(VI) concomitantly, making it a promising candidate for treating mixed-waste sites such as the Oak Ridge IFC site . These metabolic capabilities distinguish G. lovleyi from closely related Geobacter isolates, including its closest cultured relative, G. thiogenes .

What are the optimal conditions for expressing recombinant Geobacter lovleyi uppP?

For optimal expression of recombinant G. lovleyi uppP, researchers should consider several expression systems based on their specific experimental needs:

Expression SystemAdvantagesConsiderationsSuitable Applications
E. coliHigh yield, rapid growth, well-established protocolsMay lack post-translational modifications, potential inclusion body formationStructural studies, antibody production
YeastEukaryotic post-translational modifications, secretion capacityLower yields than E. coli, longer culture timeFunctional studies requiring proper folding
BaculovirusHigh expression levels, complex post-translational modificationsTechnical complexity, longer production timeStructural and functional studies
Mammalian cellNative-like post-translational modificationsHighest cost, longest production time, technical complexityStudies requiring authentic protein activity

For membrane proteins like uppP, E. coli-based expression systems often require optimization of induction conditions, temperature, and detergent selection for solubilization . Since uppP is a hydrophobic protein with multiple transmembrane domains, expression strategies that employ mild solubilization conditions or membrane-mimetic environments may enhance proper folding and stability of the recombinant protein.

What methods can be used to detect and quantify Geobacter lovleyi in environmental samples?

Several molecular techniques can be employed to detect and quantify G. lovleyi in environmental samples:

  • Direct PCR: Using specific 16S rRNA gene-targeted primer pairs such as Geo196F/Geo535R can distinguish G. lovleyi strain SZ from other chlorinated ethene-dechlorinating bacteria and closely related Geobacter isolates. This approach has a detection limit of approximately 1 × 10^6 16S rRNA gene copies per μl of template DNA .

  • Nested PCR: This more sensitive approach can detect as few as 1 × 10^4 16S rRNA gene copies per μl of template DNA .

  • Quantitative Real-Time PCR (qPCR): Using SYBR green-based detection chemistry with specific primers like Geo196F/Geo535R, qPCR can detect as few as 30 16S rRNA gene copies per μl of template DNA. The PCR conditions typically involve: 2 min at 50°C, 15 min at 95°C followed by 40 cycles of 30 s at 94°C, 30 s at 50°C, and 30 s at 72°C .

To convert gene copy numbers to cell numbers, it's important to note that the G. lovleyi strain SZ genome contains two 16S rRNA gene copies, so dividing gene copy numbers by a factor of 2 yields the cell numbers .

How can researchers effectively purify recombinant Geobacter lovleyi uppP for experimental studies?

Purification of recombinant G. lovleyi uppP, being a hydrophobic membrane protein, requires specialized techniques:

  • Detergent-based extraction: After expression, cells should be lysed and the membrane fraction isolated by ultracentrifugation. The membrane protein can then be solubilized using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin that maintain protein structure and function.

  • Affinity chromatography: If the recombinant protein is expressed with tags such as the Avi-tag Biotinylated system mentioned in the product description, researchers can utilize streptavidin-based affinity chromatography for purification . This approach enables highly specific capture of the biotinylated protein.

  • Size exclusion chromatography: As a final polishing step, size exclusion chromatography can separate the purified protein from aggregates and other contaminants.

For quality control, SDS-PAGE analysis should confirm purity of >85% as indicated in the product specifications .

How should researchers design experiments to study bacitracin resistance conferred by uppP?

When designing experiments to study bacitracin resistance conferred by uppP in G. lovleyi, researchers should consider the following approach:

  • Gene knockout/knockdown studies: Create uppP mutants in G. lovleyi using appropriate genetic tools. Based on studies in E. faecalis, expect increased susceptibility to bacitracin in uppP mutants compared to wild-type strains .

  • Complementation studies: Re-introduce the uppP gene into mutant strains to confirm the role of uppP in bacitracin resistance. In E. faecalis, when uppP was expressed in a wild-type background, the MIC of bacitracin increased significantly from 32-48 mg/L to 128-≥256 mg/L .

  • Expression analysis: Monitor uppP expression under various conditions using techniques such as qPCR or reporter gene fusion constructs (e.g., uppP-lacZ). In E. faecalis, uppP expression was constitutive and not affected by bacitracin or other cell wall-active antimicrobials .

  • MIC determination: Use standardized methods to determine the minimum inhibitory concentration (MIC) of bacitracin against wild-type, mutant, and complemented strains. Based on E. faecalis data, wild-type G. lovleyi might exhibit MICs in the range of 30-50 mg/L, while uppP mutants might show MICs of 3-6 mg/L .

  • Controls: Include tests with other antimicrobials (e.g., cefoxitin, teicoplanin, vancomycin) to confirm specificity of the bacitracin resistance phenotype .

What experimental controls are essential when studying Geobacter lovleyi uppP function?

When studying G. lovleyi uppP function, the following controls are essential:

  • Negative controls:

    • No-template controls in PCR and qPCR reactions to identify false positives

    • Vehicle-only treatments in enzymatic assays

    • Empty vector controls in expression studies

  • Positive controls:

    • Known quantities of purified G. lovleyi 16S rRNA gene for PCR/qPCR standard curves

    • Established bacterial strains with well-characterized bacitracin resistance

    • Purified UppP from other bacterial species with known activity

  • Specificity controls:

    • Closely related Geobacter species (especially G. thiogenes) to validate specificity of detection methods

    • DNA mixtures with increasing amounts of related species (e.g., G. thiogenes) to assess potential interference in quantification

    • Testing against other antimicrobials to confirm specificity of bacitracin resistance

  • Technical controls:

    • Multiple biological and technical replicates

    • Melting curve analysis in qPCR to verify amplification specificity

    • Comparison of amplification plot shapes to distinguish between target and closely related species

How does the structure-function relationship of uppP contribute to its role in bacitracin resistance?

The structure-function relationship of uppP in bacitracin resistance involves several key aspects:

UppP belongs to the BacA-type undecaprenyl pyrophosphate phosphatase family, which typically features eight transmembrane helices forming a hydrophobic protein embedded in the cell inner membrane . The catalytic site is likely positioned to access the undecaprenyl diphosphate substrate at the membrane interface.

The mechanism of bacitracin resistance involves the dephosphorylation of undecaprenyl diphosphate (UPP) to produce undecaprenyl phosphate, which is essential for cell wall peptidoglycan synthesis . Bacitracin functions by binding to UPP, preventing its dephosphorylation and thus inhibiting cell wall synthesis. By rapidly converting UPP to undecaprenyl phosphate, uppP reduces the availability of bacitracin's target molecule, effectively conferring resistance to the antibiotic.

Advanced structural studies, such as X-ray crystallography or cryo-electron microscopy, would be valuable for identifying the specific amino acid residues involved in substrate binding and catalysis. This information could guide the development of inhibitors that might sensitize bacteria to bacitracin or other antibiotics that target cell wall synthesis.

What is the potential role of Geobacter lovleyi uppP in bioremediation applications?

G. lovleyi possesses unique metabolic capabilities that make it valuable for bioremediation, and uppP may play a significant role in these applications:

G. lovleyi strain SZ can simultaneously reduce PCE (tetrachloroethene) and U(VI) (hexavalent uranium), making it particularly useful for mixed-waste sites containing both contaminants . Since uppP confers resistance to bacitracin , it may contribute to G. lovleyi's survival in harsh environments where antimicrobial compounds might be present, either naturally or as co-contaminants.

The expression of uppP might be engineered to enhance cell wall integrity and stress resistance in G. lovleyi strains used for bioremediation. This could potentially improve their survival and activity in challenging environmental conditions. Additionally, uppP could serve as a genetic marker for monitoring G. lovleyi populations in bioremediation sites, complementing existing 16S rRNA gene-based detection methods .

Research into the relationship between uppP expression and G. lovleyi's stress response could provide insights into optimizing bioremediation strategies, particularly in sites with complex mixtures of contaminants.

How does Geobacter lovleyi uppP differ from homologous proteins in other bacterial species?

Comparative analysis reveals several differences between G. lovleyi uppP and homologous proteins in other bacterial species:

SpeciesStructural FeaturesExpression PatternBacitracin Resistance LevelOther Antimicrobial Resistances
G. lovleyiPredicted 8 transmembrane helices, inner membrane protein Likely constitutiveNot fully characterizedNot fully characterized
E. faecalis8 transmembrane helices, hydrophobic inner membrane protein Constitutive, not induced by bacitracinWild-type MIC: 32-48 mg/L, uppP knockout: 3-6 mg/L, overexpression: 128-≥256 mg/L uppP does not affect susceptibility to cefoxitin, teicoplanin, vancomycin, gentamicin, enrofloxacin, and d-cycloserine
E. coliBacA-type UppP with similar structureVaries with growth conditionsModerateVariable

While G. lovleyi uppP shares structural similarities with homologs in other bacteria, its specific role in the unique metabolic capabilities of G. lovleyi (such as PCE and U(VI) reduction) may involve additional functions or regulatory interactions not present in other species. Advanced genomic and proteomic analyses could reveal species-specific adaptations of uppP that contribute to G. lovleyi's distinctive ecological niche.

What are the major challenges in studying recombinant G. lovleyi uppP, and how can they be addressed?

Researchers face several challenges when studying recombinant G. lovleyi uppP:

  • Membrane protein expression: As a hydrophobic protein with multiple transmembrane domains, uppP can be difficult to express in functional form.

    • Solution: Use specialized expression systems designed for membrane proteins, such as C41/C43 E. coli strains or cell-free expression systems with lipid nanodiscs.

  • Protein solubility: Maintaining uppP in solution without aggregation is challenging.

    • Solution: Screen multiple detergents (DDM, LMNG, digitonin) at various concentrations to identify optimal solubilization conditions. Consider using membrane-mimetic systems like nanodiscs or amphipols.

  • Activity assays: Developing reliable assays for uppP activity.

    • Solution: Adapt phosphatase assays using synthetic undecaprenyl diphosphate substrates and measure either the release of inorganic phosphate or the formation of undecaprenyl phosphate using chromatographic methods.

  • Specificity in environmental detection: Differentiating G. lovleyi from closely related Geobacter species.

    • Solution: Use the specific Geo196F/Geo535R primer pair, validate with melting curve analysis, and distinguish strains by comparing amplification plot shapes in qPCR .

How can researchers accurately quantify bacitracin resistance levels conferred by uppP?

To accurately quantify bacitracin resistance levels conferred by uppP, researchers should:

  • Standardize MIC determination: Use broth microdilution method according to Clinical and Laboratory Standards Institute (CLSI) guidelines with appropriate bacitracin concentration ranges. Based on E. faecalis data, test concentrations from 1 to 256 mg/L .

  • Include proper controls: Test wild-type, uppP knockout, and uppP-complemented strains in parallel. Include a known bacitracin-sensitive control strain.

  • Measure gene expression levels: Quantify uppP expression using qPCR and correlate with observed resistance levels. This is particularly important when studying strains with varying expression levels.

  • Assess growth kinetics: Beyond simple MIC determination, analyze growth curves at various bacitracin concentrations to capture subtle differences in resistance phenotypes.

  • Test for cross-resistance: Examine whether uppP confers resistance to other antimicrobials or if the resistance is specific to bacitracin, as observed in E. faecalis .

  • Environmental factors: Evaluate how environmental conditions (pH, temperature, nutrient availability) might affect the resistance phenotype, as these could be relevant for environmental applications.

What emerging technologies could enhance our understanding of G. lovleyi uppP function?

Several emerging technologies could significantly advance our understanding of G. lovleyi uppP function:

  • Cryo-electron microscopy: This technique could reveal the detailed 3D structure of uppP in its native membrane environment, providing insights into its mechanism of action and potential for inhibitor design.

  • Single-cell techniques: Methods like single-cell RNA-seq could help understand uppP expression heterogeneity within G. lovleyi populations, particularly in complex environmental samples.

  • Biosensors: Development of biosensors that can report on uppP activity in real-time would enable dynamic studies of its function during bacterial growth and under various stresses.

  • CRISPR-Cas9 genome editing: More precise genetic manipulation of G. lovleyi could allow for subtle modifications of uppP structure and regulation to understand specific structure-function relationships.

  • Artificial intelligence approaches: Machine learning algorithms could help predict how sequence variations in uppP affect its function and identify potential inhibitors targeted specifically to G. lovleyi uppP.

How might Geobacter lovleyi uppP research contribute to addressing antimicrobial resistance?

Research on G. lovleyi uppP could contribute to addressing antimicrobial resistance in several ways:

  • Novel antibiotic targets: Understanding the structure and function of uppP could lead to the development of new antimicrobials that target this enzyme, potentially overcoming existing resistance mechanisms.

  • Resistance mechanisms: Insights into how uppP confers bacitracin resistance could reveal general principles of how bacteria evolve resistance to cell wall-targeting antibiotics.

  • Combination therapies: Knowledge of uppP function might suggest effective antibiotic combinations that target complementary aspects of cell wall synthesis.

  • Ecological insights: Understanding how resistance genes like uppP function in environmental bacteria like G. lovleyi could provide insights into the environmental reservoirs and transfer of resistance genes.

  • Bioinformatic screening: Developing computational tools to identify and characterize uppP homologs across bacterial species could help predict antibiotic resistance profiles in clinical isolates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.