Recombinant Geobacter metallireducens Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Geobacter metallireducens Apolipoprotein N-acyltransferase (lnt)

Recombinant Geobacter metallireducens Apolipoprotein N-acyltransferase (lnt) is a bioengineered enzyme derived from the Gram-negative metal-reducing bacterium G. metallireducens. This protein is homologous to bacterial lipoprotein N-acyltransferases, which catalyze the post-translational modification of lipoproteins by transferring fatty acids to their N-terminal cysteine residues. In G. metallireducens, this enzyme likely plays a role in membrane remodeling or pathogenicity, though its specific function remains under investigation.

Biochemical Characteristics and Production

The recombinant lnt protein is synthesized via heterologous expression systems, often in E. coli, and is marketed as a purified product for research applications. Key specifications include:

ParameterDetails
Source OrganismGeobacter metallireducens (strain GS-15/ATCC 53774/DSM 7210)
Uniprot IDQ39T32
Expression HostTypically E. coli (exact host not specified in sources)
TagDetermined during production; no specific tag mentioned
Storage BufferTris-based buffer with 50% glycerol
PurityHigh-purity recombinant protein (exact method unspecified)
Molecular Weight~59 kDa (inferred from sequence length: 521 amino acids)

Lipoprotein Modification

In Gram-negative bacteria (e.g., E. coli), lnt catalyzes the N-terminal acylation of lipoproteins, which is critical for membrane integrity and protein stability. For example:

  • Triacylglycerol Formation: In Mycobacterium tuberculosis, Lnt homologs transfer fatty acids to lipoprotein N-termini, forming triacylated lipoproteins that interact with host immune receptors .

  • Membrane Adaptation: In G. metallireducens, such modifications may enhance membrane stability under anaerobic or metal-rich environments .

Comparative Genomic Analysis

The lnt gene in G. metallireducens shows divergence from other Geobacter species:

SpeciesGenomic FeaturesLnt Activity
G. metallireducensChromosome: 3,997,420 bp; GC content: 59.51% Inferred from homologs
G. sulfurreducensChromosome: ~3.4 Mbp; GC content: ~60% Not reported
Mycobacterium tuberculosisGC-rich genome; Lnt homologs confirmed Experimentally verified

Challenges and Future Directions

  • Functional Gaps: Direct biochemical assays to confirm G. metallireducens lnt’s substrate specificity (e.g., fatty acid donors) are lacking.

  • Structural Studies: High-resolution structures of the enzyme could elucidate its catalytic mechanism.

  • Ecological Relevance: Potential roles in biofilm formation or metal reduction remain unexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lnt; Gmet_2367; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-521
Protein Length
full length protein
Species
Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)
Target Names
lnt
Target Protein Sequence
MDYRRLRMPDFDAIPRRDYLMAVLSGVLLALSFPSPGISPLAWIAFAPLLLACGRKDPRK AFRLGFVTGLAAYAGILYWITIVVTTYGKLPWIVSVGVLSMLVSYLALYPAVVAYLVRRG EERGISLLISFPLLWVGLEYGRAFLVTGFPWASLGYTQYRTLPLIQIADITGVYGLSFLI ALANVVLFRIIRGFAAREPAPYPVKSVVLLLVLLLVTIAYGFKRLHVPEGGAPFKVALIQ GNIDQNIKWDPSFQEETVAIYERLSRKACAAGPSDLLVWPESAAPFYFQDEPRYASRIKG LARELKTCAVVGSPAFEKDGERLKYLNSAFLLSPWGDVIGRSDKIHLVPFGEYVPMAKLL PFVNKLVAGIGDFSPGAQIAALDTGKGRIGILVCFEGIFPELSRAYVRAGSRLLVNITND AWFGRSSAPYQHISMTVFRAVENRVPLVRAANTGITSIIDSRGHIRGMTPLFQEAVLNGE VRLGEGESFYNRYGDVFAWACVAGAAVVAALAFRRKSIHHQ
Uniprot No.

Target Background

Function
This enzyme catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, representing the final step in lipoprotein maturation.
Database Links
Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase (lnt) and what is its function in Geobacter metallireducens?

Apolipoprotein N-acyltransferase (lnt) in Geobacter metallireducens is an enzyme classified under EC 2.3.1.- that plays a critical role in bacterial lipoprotein biogenesis. It catalyzes the N-acylation of apolipoproteins, a key step in the maturation of bacterial lipoproteins that are essential for membrane integrity and function . The enzyme is encoded by the lnt gene (locus name: Gmet_2367) in G. metallireducens strain GS-15 / ATCC 53774 / DSM 7210 .

Functionally, lnt transfers an acyl group from membrane phospholipids to the N-terminal cysteine residue of apolipoprotein substrates, converting them to mature lipoproteins. This post-translational modification is crucial for proper insertion and anchoring of lipoproteins in the bacterial cell membrane. In G. metallireducens, these lipoproteins likely contribute to the organism's unique ability to completely oxidize organic compounds using Fe(III) oxide as an electron acceptor, a metabolic capability that distinguishes this species in environmental and bioremediation contexts .

How does G. metallireducens lnt compare to homologous proteins in related species?

Comparison between G. metallireducens lnt and its homolog in G. sulfurreducens reveals important similarities and differences:

FeatureG. metallireducens lntG. sulfurreducens lntSignificance
Amino acid length521 residues477 residuesG. metallireducens has a longer sequence
UniProt accessionQ39T32P61035Different database identifiers
Locus nameGmet_2367GSU2281Different genomic locations
Sequence identity100% (self)~70% (estimated)High conservation suggesting similar function
N-terminal regionMDYRRLRMPDFDAIPRRMPGFNAVPRRDifferent N-terminal sequences may affect localization
Catalytic domainsConservedConservedCore enzymatic function preserved

What are the optimal conditions for expression and purification of recombinant G. metallireducens lnt?

The expression and purification of recombinant G. metallireducens lnt requires careful optimization due to its membrane-associated nature. Based on available protocols for similar proteins, the following methodology is recommended:

Expression System Selection:

  • E. coli expression systems with controlled induction (IPTG-inducible T7 promoter) are typically suitable

  • Consider using E. coli strains optimized for membrane protein expression (C41, C43, or Lemo21)

  • Expression at lower temperatures (16-20°C) after induction may improve proper folding

Solubilization and Purification Strategy:

  • Cell lysis using mechanical disruption (French press or sonication) in buffer containing protease inhibitors

  • Membrane fraction isolation by ultracentrifugation

  • Solubilization using mild detergents (n-dodecyl-β-D-maltoside or CHAPS) at concentrations above CMC

  • Affinity purification using an appropriate tag (His-tag is commonly used)

  • Size exclusion chromatography for final purification

Buffer Optimization:

  • Include glycerol (10-15%) to stabilize the protein

  • Consider using the same Tris-based buffer with 50% glycerol as specified for the commercial product

  • pH optimization typically in the range of 7.0-8.0

  • Include reducing agents (DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

After purification, storage recommendations align with commercial product specifications: storage at -20°C for regular use or -80°C for extended storage, with avoidance of repeated freeze-thaw cycles . Working aliquots may be stored at 4°C for up to one week to minimize degradation.

What methodological approaches are recommended for assaying G. metallireducens lnt enzymatic activity?

Assaying the enzymatic activity of G. metallireducens Apolipoprotein N-acyltransferase requires specific methodological considerations:

In vitro Acyltransferase Activity Assay:

  • Substrate preparation: Synthetic apolipoprotein substrates with an N-terminal cysteine residue

  • Acyl donor: Phospholipids (typically phosphatidylethanolamine) extracted from bacterial membranes or synthetic sources

  • Reaction conditions: Buffer system maintaining pH 7.0-7.5, containing 5-10 mM MgCl₂

  • Detection methods: Either radiolabeled substrates or mass spectrometry to detect acylated products

  • Controls: Heat-inactivated enzyme preparation as negative control

Analysis Methods:

  • Thin-layer chromatography (TLC) for separation of reaction products

  • MALDI-TOF mass spectrometry for precise molecular mass determination of products

  • Liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS) for detailed product characterization

Kinetic Parameter Determination:

  • Vary either substrate concentration while maintaining fixed enzyme concentration

  • Measure initial reaction rates under various substrate concentrations

  • Plot data using Michaelis-Menten equation to determine Km and Vmax

  • Compare kinetic parameters with those of homologous enzymes from other species

When designing these assays, it is important to consider the membrane-associated nature of the enzyme and the potential need for detergents or artificial membrane systems to maintain proper protein folding and activity. The method should be validated using known inhibitors of acyltransferases or by demonstrating dependence on essential cofactors.

How does G. metallireducens adapt its metabolism in different growth conditions, and what is the role of lnt?

G. metallireducens demonstrates remarkable metabolic adaptability to different growth conditions, with potential implications for lnt expression and function:

Carbon Source Utilization Patterns:
G. metallireducens can utilize various carbon sources, including benzoate and acetate, with distinct metabolic adaptations for each substrate . When growing on complex carbon sources like benzoate, G. metallireducens upregulates several energy-inefficient reactions not present in related organisms like G. sulfurreducens . These metabolic shifts likely affect membrane composition and possibly lnt activity.

Experimental Evidence of Metabolic Adaptation:
In sediment column experiments, G. metallireducens cultured with benzoate and nitrate (as electron acceptor) showed specific adaptations to sessile growth conditions . Growth medium typically includes:

  • NaHCO₃: 2.5 g L⁻¹

  • NH₄Cl: 1.5 g L⁻¹

  • NaH₂PO₄: 0.60 g L⁻¹

  • KCl: 0.10 g L⁻¹

  • Na-benzoate: 1 mM

  • Fe(III)-citrate: 0.5 mM (which enhances nitrate reductase activity)

  • pH 6.8

  • 30 mM NaNO₃ as electron acceptor

Implications for lnt Activity:
The adaptation to different carbon sources likely influences membrane lipid composition, which in turn affects:

  • The availability of acyl donors for lnt-catalyzed reactions

  • The expression levels of lnt itself, as part of the cellular response to changing environmental conditions

  • The specific lipoproteins being processed by lnt, which may vary depending on metabolic needs

Proteomic analyses of G. metallireducens under different growth conditions have shown that when growing with benzoate, genes encoding energy-inefficient reactions are upregulated compared to growth with acetate . This suggests that lnt may be differentially regulated based on carbon source, potentially to support membrane remodeling necessary for adaptation to complex substrates.

What role does G. metallireducens lnt play in the context of genome-scale metabolic models?

Genome-scale metabolic models of G. metallireducens provide valuable insights into the metabolic network and potential role of lnt:

Integration into Metabolic Models:
The genome-scale constraint-based model of G. metallireducens includes 747 genes and 697 reactions, creating a comprehensive framework for understanding cellular metabolism . While lnt-specific reactions may not be explicitly modeled in current versions, the protein's role in lipoprotein processing has important implications for membrane function and cellular energetics.

Metabolic Network Context:
G. metallireducens contains several energy-inefficient reactions not present in G. sulfurreducens, which affects biomass yield predictions . The experimental biomass yield of G. metallireducens growing on pyruvate was observed to be lower than the predicted optimal yield, suggesting potential regulatory mechanisms affecting energy efficiency . As a membrane-associated protein involved in lipoprotein processing, lnt function may indirectly influence these energy efficiency parameters through effects on membrane integrity and composition.

Model Applications:
Researchers using genome-scale models can investigate:

  • The impact of lnt gene knockouts on predicted growth and metabolism

  • The energetic costs associated with lipoprotein processing under different growth conditions

  • The integration of proteomic data on lnt expression with metabolic flux predictions

Methodological Considerations:
When incorporating lnt functions into metabolic models, researchers should:

  • Include reactions representing the acyltransferase activity and its energetic requirements

  • Consider the specific lipids serving as acyl donors and their abundance under different conditions

  • Account for the potential regulatory relationships between carbon metabolism and membrane protein processing

What are the recommended storage and handling conditions for recombinant G. metallireducens lnt?

Proper storage and handling of recombinant G. metallireducens Apolipoprotein N-acyltransferase is critical for maintaining protein stability and activity:

Storage Recommendations:

  • Long-term storage: -20°C or -80°C (preferred for extended storage)

  • Working aliquots: 4°C for up to one week

  • Buffer composition: Tris-based buffer with 50% glycerol, optimized for this specific protein

Handling Best Practices:

  • Avoid repeated freeze-thaw cycles, which can lead to protein denaturation and loss of activity

  • Prepare small working aliquots to minimize freeze-thaw events

  • Thaw frozen protein samples on ice to minimize thermal stress

  • When diluting from storage concentration, use buffers pre-equilibrated to 4°C

  • Consider adding protease inhibitors when handling the protein for extended periods

Stability Considerations:

  • Temperature sensitivity: The protein may lose activity if exposed to temperatures above 4°C for extended periods

  • Oxidation sensitivity: Consider using reducing agents in working buffers to prevent oxidation of cysteine residues

  • pH stability: Maintain pH in the range of 7.0-8.0 to prevent acid/base-catalyzed degradation

  • Detergent compatibility: If working with the membrane-associated form, ensure compatible detergents are used at appropriate concentrations

Following these storage and handling recommendations will help ensure the integrity and activity of the recombinant protein for experimental applications.

How can researchers design effective experiments to study G. metallireducens lnt in the context of bacterial adaptation?

Designing experiments to investigate G. metallireducens lnt in adaptation studies requires careful planning and consideration of multiple factors:

Experimental Approaches:

  • Comparative Growth Studies:

    • Culture G. metallireducens under various conditions (different carbon sources, electron acceptors)

    • Monitor growth parameters (biomass yield, growth rate) in wild-type vs. lnt-modified strains

    • Analyze membrane composition changes using lipidomics approaches

  • Gene Expression Analysis:

    • Use qRT-PCR to quantify lnt expression under different growth conditions

    • Employ RNA-seq for genome-wide expression analysis to identify co-regulated genes

    • Compare expression patterns between benzoate and acetate growth conditions

  • Sediment Column Experiments:

    • Implement the methodological approach described in search result :

      • Use anoxic freshwater medium with appropriate supplements

      • Maintain anoxic conditions using N₂:CO₂ (90:10) atmosphere

      • Monitor oxygen levels using optical sensor spots

      • Employ flow rates of approximately 18 ml h⁻¹

      • Allow for bacterial settlement prior to continuous flow

  • Proteomics Analysis:

    • Compare protein expression profiles under different growth conditions

    • Focus on membrane protein fractions to identify co-regulated proteins

    • Quantify lnt abundance and post-translational modifications

Experimental Design Considerations:

Experimental FactorRecommendationRationale
Growth medium compositionInclude Fe(III)-citrate (0.5 mM)Enhances nitrate reductase activity in G. metallireducens
Culture temperature30°COptimal for G. metallireducens growth
Sampling frequencyEvery 4-8 hours during growthCaptures temporal expression patterns
Biological replicatesMinimum of 3Ensures statistical significance
ControlsG. sulfurreducens culturesAllows comparison with related species

When analyzing results, researchers should correlate lnt expression and activity with specific adaptive responses, particularly focusing on membrane composition changes and the efficiency of energy generation under different growth conditions.

What analytical techniques are most appropriate for studying the structural and functional aspects of G. metallireducens lnt?

Multiple analytical techniques can be employed to investigate structural and functional aspects of G. metallireducens Apolipoprotein N-acyltransferase:

Structural Analysis Techniques:

  • X-ray Crystallography:

    • Challenges: Membrane proteins like lnt are difficult to crystallize

    • Approach: Use detergent screening and lipidic cubic phase crystallization

    • Outcome: High-resolution 3D structure determination

  • Cryo-Electron Microscopy:

    • Advantages: Does not require crystallization

    • Application: Visualization of lnt in native-like membrane environments

    • Resolution: Near-atomic resolution increasingly achievable for membrane proteins

  • Nuclear Magnetic Resonance (NMR):

    • Suitable for: Dynamic studies of protein regions

    • Limitations: Challenging for full-length membrane proteins

    • Value: Provides information on protein dynamics not available from static structures

Functional Analysis Techniques:

  • Site-Directed Mutagenesis:

    • Target conserved residues identified by sequence alignment with G. sulfurreducens lnt

    • Assess activity changes to identify catalytic and substrate-binding residues

    • Create chimeric proteins to investigate species-specific functional differences

  • Lipidomics and Proteomics:

    • Mass spectrometry-based analysis of lipid profiles under different conditions

    • Identification of lipoprotein substrates processed by lnt

    • Quantitative proteomics to measure changes in membrane protein composition

  • Microscopy Techniques:

    • Fluorescence microscopy with tagged lnt to determine subcellular localization

    • Super-resolution microscopy to visualize membrane distribution patterns

    • Correlative light and electron microscopy for contextual structural information

Integrated Analytical Workflow:

An ideal analytical strategy would combine multiple techniques:

  • Initial biochemical characterization using recombinant protein

  • Functional analysis through enzyme assays and substrate identification

  • Structural studies using complementary approaches

  • In vivo validation using genetic manipulation and phenotypic analysis

This multi-technique approach provides comprehensive understanding of both structural features and functional roles of G. metallireducens lnt in its biological context.

How can G. metallireducens lnt research contribute to bioremediation applications?

G. metallireducens is known for its unique capabilities in bioremediation contexts, particularly in the degradation of organic compounds coupled to Fe(III) reduction . Understanding the role of Apolipoprotein N-acyltransferase (lnt) in this organism offers several potential contributions to bioremediation applications:

Membrane Adaptation to Contaminants:
Lnt's role in processing lipoproteins directly affects membrane integrity and composition, which is crucial for adaptation to environments containing organic pollutants. By characterizing how lnt activity changes when G. metallireducens is exposed to different contaminants, researchers can better understand adaptive mechanisms that enable effective bioremediation.

Optimization of Bioremediation Conditions:
Knowledge of how lnt expression and activity respond to different growth conditions can inform the development of optimized protocols for bioremediation applications. For instance, the finding that G. metallireducens upregulates energy-inefficient reactions when growing on complex carbon sources like benzoate suggests that manipulation of lnt activity might influence the organism's efficiency in degrading complex pollutants.

Engineered Systems for Enhanced Performance:
Research into lnt function could lead to engineered G. metallireducens strains with modified membrane properties for improved bioremediation performance. Potential approaches include:

  • Overexpression of lnt to enhance lipoprotein processing and potentially increase membrane stability

  • Modification of lnt substrate specificity to alter membrane composition for better tolerance to specific contaminants

  • Co-expression of lnt with specific lipoproteins involved in contaminant degradation pathways

Methodological Framework for Field Applications:
The experimental approaches used in laboratory studies, such as sediment column experiments , provide valuable methodological frameworks that can be adapted for field-scale bioremediation applications. These methods include techniques for maintaining anoxic conditions, monitoring bacterial distribution, and analyzing metabolic activities in complex environmental matrices.

What are the key research gaps and future directions in understanding G. metallireducens lnt function?

Despite available information on G. metallireducens Apolipoprotein N-acyltransferase, several significant research gaps remain that represent important directions for future investigation:

Structural Characterization Needs:

  • High-resolution structural determination of G. metallireducens lnt

  • Identification of catalytic residues and substrate binding sites

  • Comparative structural analysis with homologs from other bacterial species

Substrate Specificity Questions:

  • Comprehensive identification of natural lipoprotein substrates in G. metallireducens

  • Determination of lipid preferences for acyl group donation

  • Investigation of potential regulatory mechanisms affecting substrate selection

Physiological Role Uncertainties:

  • Precise contribution of lnt to G. metallireducens adaptation to different electron acceptors

  • Role in biofilm formation and attachment to iron oxides and other minerals

  • Relationship between lnt activity and extracellular electron transfer mechanisms

Technical Challenges:

  • Development of improved expression systems for producing functional recombinant lnt

  • Creation of specific antibodies or activity-based probes for monitoring lnt in complex samples

  • Establishment of high-throughput screening methods for identifying lnt inhibitors or activators

Integrative Research Opportunities:
Future research should adopt integrative approaches combining:

  • Systems biology: Integration of lnt into comprehensive metabolic models

  • Comparative genomics: Analysis of lnt evolution across Geobacteraceae

  • Synthetic biology: Engineering lnt variants with novel properties

  • Environmental microbiology: Understanding lnt function in complex microbial communities

Addressing these research gaps will provide a more complete understanding of G. metallireducens lnt function and its applications in biotechnology and bioremediation.

How does understanding G. metallireducens lnt contribute to broader knowledge in microbial physiology?

Research on G. metallireducens Apolipoprotein N-acyltransferase contributes to fundamental understanding in several areas of microbial physiology:

Membrane Biogenesis and Adaptation:
Lnt's role in lipoprotein processing provides insights into how bacteria adapt their membranes to different environmental conditions. G. metallireducens, with its metabolic versatility and ability to use various electron acceptors , serves as an excellent model for studying membrane adaptations to changing redox conditions. This knowledge extends beyond Geobacter to inform broader principles of how prokaryotic membranes adapt to environmental stresses.

Energy Conservation Mechanisms:
The observation that G. metallireducens contains energy-inefficient reactions not present in related species like G. sulfurreducens raises important questions about the relationship between energy conservation and membrane composition. Lnt's role in processing membrane lipoproteins may be integral to balancing energy efficiency with other physiological requirements, offering insights into microbial energy management strategies.

Evolution of Specialized Metabolic Capabilities:
G. metallireducens was the first organism isolated that can completely oxidize organic compounds with Fe(III) oxide as electron acceptor . Understanding how lnt contributes to this specialized metabolic capability provides perspective on the evolution of unique physiological traits in bacteria. Comparative analysis of lnt across species with different metabolic capabilities can illuminate how membrane protein processing co-evolved with specialized metabolism.

Microbial Community Interactions:
In natural environments, G. metallireducens exists within complex microbial communities. The role of lnt in adapting the cell surface may influence interactions with other microorganisms. Research on lnt therefore contributes to understanding the molecular basis of microbial community dynamics, particularly in environments where electron transfer between species is important.

By advancing knowledge in these fundamental areas of microbial physiology, research on G. metallireducens lnt extends well beyond this specific protein to inform broader principles of how bacteria adapt to and modify their environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.