Recombinant Geobacter metallireducens ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Functional Role of ATP Synthase Subunit a (atpB)

ATP synthase subunit a (atpB) in G. metallireducens is integral to the F0 sector, where it interacts with subunit c to form a proton channel. This channel enables proton flow across the membrane, coupling electrochemical gradients to ATP synthesis. The enzyme is essential for energy conservation under anaerobic conditions, particularly during metal respiration .

Recombinant Protein Characteristics

Recombinant atpB is produced in E. coli with an N-terminal His tag for purification. Key features include:

ParameterDetails
UniProt IDQ39QA3 (G. metallireducens GS-15) / C6E8P0 (Geobacter sp.)
Amino Acid Sequence1-229 residues (full length)
TagHis tag (N-terminal)
Expression SystemE. coli
StorageTris-based buffer with 50% glycerol; store at -20°C or -80°C
PurityConfirmed via SDS-PAGE

Research Applications

  1. Mechanistic Studies: Used to investigate proton translocation mechanisms in metal-reducing bacteria .

  2. Biotechnology: Serves as a template for engineering synthetic ATP synthases in bioenergy systems .

  3. Environmental Remediation: Insights into ATP metabolism inform strategies for enhancing microbial electron transfer in bioremediation .

Comparative Analysis of Available Recombinant Products

VendorCreative Biomart Creative BioMart
Catalog NumberCSB-CF659964GBJRFL31637GF
Expression Region1-229 residues1-229 residues
Tag PositionDetermined during productionN-terminal
HostE. coliE. coli
Key ApplicationsELISA, enzymatic assaysStructural studies, protein interaction assays

Current Research Gaps

  • Structural Data: No high-resolution structures of G. metallireducens atpB are available, though homologous bacterial ATP synthase structures (e.g., E. coli) provide indirect insights .

  • Functional Assays: Limited published data on enzymatic activity or proton transport efficiency of the recombinant protein .

Future Directions

  • Cryo-EM Studies: To resolve the molecular architecture of the F0 sector in G. metallireducens.

  • Metabolic Engineering: Leverage recombinant atpB to optimize ATP synthesis in bioelectrochemical systems .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Gmet_3359; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)
Target Names
atpB
Target Protein Sequence
MVHPLLFLQFFRKLLEPLHISEAGADAIAYTWLIIVFLLIVSLIATKALKAVPTGMQNFM EVVVGGIENMVEETMGEKGRPYFPLIATLALFVLVSNLIGLIPGFFPPTANLNTTAACAI IVFLSTHVVGIKKHGFHYLQHFMGPIWWLAPLMFFIEIIGHLSRPLSLSLRLFGNMNGHE LVLMIFFALAPFLVPLPMMLMGVLVSFIQAFVFMLLAMIYIQGSLEEAH
Uniprot No.

Target Background

Function
As a key component of the proton channel, this subunit plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ATP synthase subunit a in Geobacter metallireducens?

ATP synthase subunit a in G. metallireducens is a critical component of the F0 sector of the ATP synthase complex. This hydrophobic subunit forms part of the proton channel that allows protons to flow through the membrane, thereby coupling the proton gradient to ATP synthesis. Similar to what has been observed in other organisms, subunit a likely provides a physical connection between the proton channel and other subunits of the peripheral stalk . The protein plays an essential role in energy generation, allowing G. metallireducens to thrive in anaerobic environments during processes like metal reduction and bioremediation.

What expression systems are most effective for producing recombinant G. metallireducens atpB?

Table 1: Comparison of Expression Systems for Recombinant G. metallireducens atpB

Expression SystemAdvantagesLimitationsYield (mg/L)Recommended Conditions
E. coli BL21(DE3)Well-established, economicalPotential toxicity, incorrect folding0.5-2.0IPTG induction at 18°C for 16h
E. coli C41/C43Designed for membrane proteinsLower yield than specialized systems1.0-3.00.5mM IPTG at OD600=0.6, 20°C
Geobacter sulfurreducensNative protein processingComplex cultivation, low yield0.2-0.8Anaerobic conditions required
Cell-free systemAvoids toxicity issuesExpensive, optimization required0.3-1.5Detergent supplementation needed

For optimal expression of G. metallireducens atpB, E. coli C41/C43 strains are generally preferred due to their specialization for membrane protein expression. These strains provide a balance of yield and proper folding. The expression vector should contain a strong inducible promoter (T7 or tac) and include a fusion tag (His6 or MBP) to facilitate purification. For increased stability, consider co-expression with other ATP synthase subunits, particularly subunit c, as evidence from other ATP synthase studies suggests improved folding when multiple subunits are co-expressed .

What purification strategies yield the highest purity and stability for recombinant G. metallireducens atpB?

Purification of recombinant G. metallireducens atpB requires specific approaches due to its hydrophobic nature as a membrane protein. A multi-step protocol is recommended:

  • Membrane isolation: Following cell lysis, centrifuge at 10,000×g to remove cell debris, then ultracentrifuge at 100,000×g to isolate membrane fractions.

  • Solubilization: Carefully select detergents based on downstream applications. n-Dodecyl β-D-maltoside (DDM) at 1% is often effective for maintaining structure while providing good solubilization.

  • Affinity chromatography: If a His-tag was incorporated, use Ni-NTA chromatography with detergent-containing buffers (typically 0.05% DDM). Include 20-40 mM imidazole in wash buffers to reduce non-specific binding.

  • Size exclusion chromatography: Apply to a Superdex 200 column equilibrated with a buffer containing 150 mM NaCl, 20 mM Tris-HCl (pH 7.5), and 0.02% DDM to separate oligomeric states and remove aggregates.

  • Stability enhancement: Include 10% glycerol and 1 mM DTT in storage buffers to prevent degradation. Store aliquots at -80°C to maintain activity.

This approach typically yields protein with >90% purity suitable for structural and functional studies, though yield may be limited to 0.5-1.5 mg/L of culture due to the challenging nature of membrane protein purification.

How can researchers verify the functional integrity of purified recombinant G. metallireducens atpB?

Functional verification requires several complementary approaches:

  • Proton translocation assay: Reconstitute the purified protein into liposomes containing a pH-sensitive fluorophore (e.g., ACMA). Upon energization with an artificial proton gradient, monitor fluorescence quenching, which indicates proton translocation activity.

  • Reconstitution studies: Combine purified atpB with other ATP synthase subunits to assess complex formation and ATP synthesis activity. This can be performed using a hybrid approach where the recombinant atpB complements subunit a-deficient ATP synthase complexes.

  • Binding assays: Verify interaction with other ATP synthase components using pull-down assays or surface plasmon resonance. Particular attention should be paid to interactions with the c-ring and peripheral stalk components, as these are critical for function .

  • Circular dichroism spectroscopy: Confirm proper secondary structure content, particularly the expected high α-helical content characteristic of this membrane protein.

  • Thermal shift assays: Assess protein stability under various buffer conditions to optimize storage and handling procedures.

How do mutations in G. metallireducens atpB affect ATP synthase assembly and electron transfer capacity?

Mutations in G. metallireducens atpB can significantly impact both ATP synthase assembly and the cell's electron transfer capabilities. Based on studies of ATP synthase in other organisms, several key effects may occur:

Table 2: Effects of Key atpB Mutations on ATP Synthase Function

Mutation TargetStructural ImpactFunctional ConsequenceCompensatory Response
Proton channel residuesAltered half-channel geometryDecreased proton translocationUpregulation of electron transport chain components
Subunit interface residuesDisrupted a-c ring interactionImpaired rotary mechanismIncreased expression of redox-active proteins
Peripheral stalk contactsWeakened stator connectionUnstable complex assemblyEnhanced TCA cycle flux
Transmembrane helicesAltered membrane integrationDecreased complex stabilityMetabolic rewiring toward fermentation

What methodological approaches can overcome challenges in structural studies of G. metallireducens atpB?

Structural studies of membrane proteins like G. metallireducens atpB present significant challenges. Advanced methodological approaches to address these include:

  • Cryo-electron microscopy (cryo-EM):

    • Sample preparation: Utilize nanodiscs or amphipols instead of detergent micelles to maintain a more native-like environment

    • Grid optimization: Implement Spotiton or chameleon systems for more consistent sample vitrification

    • Data processing: Apply 3D variability analysis to capture different conformational states

  • X-ray crystallography optimization:

    • Fusion protein approach: Insert a crystallization chaperone (e.g., BRIL, rubredoxin) into a loop region to facilitate crystal contacts

    • LCP crystallization: Use lipidic cubic phase methods specifically designed for membrane proteins

    • Surface entropy reduction: Introduce mutations at surface-exposed residues to reduce entropy and promote crystal formation

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Analyze conformational dynamics and protein-protein interactions within the ATP synthase complex

    • Optimize detergent-compatible workflows to maintain protein stability during analysis

    • Implement automated sample handling to improve reproducibility

  • Integrative structural biology:

    • Combine lower-resolution techniques (SAXS, cryo-EM) with high-resolution methods (NMR of fragments, X-ray crystallography)

    • Use crosslinking mass spectrometry (XL-MS) to identify distance constraints between subunits

    • Apply computational modeling to integrate diverse experimental data

  • Site-specific incorporation of spectroscopic probes:

    • Utilize unnatural amino acid incorporation (via amber suppression) to install environment-sensitive fluorophores or spin labels

    • Measure distances and conformational changes during function using FRET or EPR spectroscopy

These methods have shown success with other membrane proteins and could be adapted specifically for G. metallireducens atpB structural studies.

How does the expression of recombinant G. metallireducens atpB affect cellular bioenergetics in heterologous systems?

Heterologous expression of G. metallireducens atpB can significantly alter host cell bioenergetics through several mechanisms:

  • Competition with native ATP synthase: Recombinant atpB may integrate into the host's ATP synthase complexes, potentially creating hybrid complexes with altered efficiency. This can disrupt the cell's energy production, particularly if the G. metallireducens protein is not fully compatible with the host machinery.

  • Membrane potential effects: Overexpression of atpB can alter membrane properties and potentially create proton leaks, disrupting the proton motive force maintenance. Studies of ATP synthase components in other systems have shown that improper stoichiometry of subunits can lead to uncoupling effects .

  • Metabolic rewiring: Host cells often respond to energy stress by altering metabolic flux. Similar to observations in G. sulfurreducens with altered ATP synthase function, heterologous systems expressing G. metallireducens atpB may show increased flux through the TCA cycle and changes in NADH oxidation rates .

  • Growth impacts: Expression of membrane proteins like atpB typically results in slower growth rates and lower biomass yields, as observed in studies with ATP synthase modifications . This effect can be quantified by monitoring growth curves, oxygen consumption rates, and ATP/ADP ratios.

  • Stress response activation: Proteomics analysis often reveals upregulation of stress response pathways, particularly those related to protein folding and membrane stress.

To minimize these effects while maximizing protein production, consider:

  • Using tightly regulated inducible promoters

  • Employing specialized host strains designed for membrane protein expression

  • Fine-tuning expression conditions (temperature, inducer concentration)

  • Co-expressing chaperones specific for membrane protein folding

What role does G. metallireducens atpB play in electron transfer during microbial fuel cell operation?

G. metallireducens atpB contributes to electron transfer in microbial fuel cells (MFCs) through several interconnected mechanisms:

  • Energy conservation: The ATP synthase complex containing atpB harnesses the proton gradient generated during respiratory electron transfer to produce ATP. This energy conservation process is critical for sustaining the electron transfer capabilities of G. metallireducens in MFCs over extended periods.

  • Redox balance maintenance: Proper ATP synthase function helps maintain cellular redox balance by allowing efficient coupling between electron transport and energy conservation. When this balance is optimized, more electrons can be directed toward external electron acceptors (electrodes in MFCs) .

  • Adaptive response regulation: ATP synthase activity serves as a metabolic sensor, influencing the expression of electron transfer components. Studies in G. sulfurreducens have shown that modifying ATP synthase function leads to increased expression of c-type cytochromes and other redox-active proteins involved in extracellular electron transfer .

  • Proton gradient management: The atpB subunit's proton channel function helps regulate cytoplasmic pH and membrane potential, which are critical parameters affecting the thermodynamics of electron transfer to external acceptors.

Table 3: Relationship Between ATP Synthase Activity and MFC Performance Parameters

ATP Synthase ParameterEffect on Cellular PhysiologyImpact on MFC PerformanceOptimization Strategy
Proton translocation efficiencyDetermines PMF utilizationAffects power densityMutation of key channel residues
Expression levelInfluences energy conservation ratioChanges coulombic efficiencyPromoter engineering
Complex stabilityDetermines long-term performanceAffects operational lifetimeStabilizing mutations
Assembly rateControls adaptation to load changesImpacts response to variable resistanceCo-expression of assembly factors

Optimizing atpB function through protein engineering could potentially enhance MFC performance by improving the balance between cellular energy needs and extracellular electron transfer.

How can directed evolution techniques be applied to enhance the functionality of recombinant G. metallireducens atpB?

Directed evolution offers powerful approaches to optimize G. metallireducens atpB for enhanced functionality in research applications:

  • Library generation methods:

    • Error-prone PCR: Introduce random mutations throughout the atpB gene with controlled mutation rates (2-5 mutations/kb)

    • Site-saturation mutagenesis: Target conserved residues in the proton channel region for comprehensive amino acid substitutions

    • DNA shuffling: Recombine atpB genes from different Geobacter species to create chimeric proteins with potentially improved properties

    • CRISPR-Cas9 based approaches: Create more targeted libraries with precise editing of specific regions

  • Selection strategies:

    • Complementation screening: Express atpB libraries in ATP synthase-deficient E. coli strains and select for restored growth

    • Proton leakage assay: Use pH-sensitive fluorescent proteins to identify variants with improved proton transport properties

    • Adaptive laboratory evolution: Apply selective pressure (similar to method used for G. sulfurreducens lactate adaptation ) to enrich for beneficial atpB mutations in Geobacter species

    • MFC-based selection: Direct selection in bioelectrochemical systems for variants that improve power output

  • High-throughput screening approaches:

    • Microfluidic droplet sorting: Encapsulate individual variants and measure ATP production or proton transport using fluorescent indicators

    • Deep mutational scanning: Combine massive parallel variant generation with next-generation sequencing to map the fitness landscape of atpB

  • Validation of improved variants:

    • Detailed biochemical characterization: Measure ATP synthesis rates, proton/ATP ratios, and stability

    • Structural analysis: Determine how beneficial mutations alter protein conformation and dynamics

    • In vivo testing: Validate performance in Geobacter species under relevant conditions

This approach has proven successful in other systems, such as the identification of single-nucleotide polymorphisms in G. sulfurreducens that dramatically improved lactate metabolism through altered transcriptional regulation .

What are the key differences between ATP synthase subunit a (atpB) from G. metallireducens and other model organisms?

G. metallireducens atpB exhibits several distinct characteristics compared to homologs from model organisms:

  • Sequence conservation: While the core functional domains show evolutionary conservation, G. metallireducens atpB contains unique regions adapted to the organism's anaerobic lifestyle and metal-reducing capabilities. Sequence analysis reveals higher conservation in the transmembrane helices forming the proton channel compared to more variable peripheral regions.

  • Structural adaptations: The protein likely contains adaptations for functioning optimally under the low-energy conditions typical of anaerobic environments. These may include modifications to the proton channel architecture that optimize the proton/ATP ratio for energy conservation.

  • Redox sensitivity: As a component from an organism specialized in metal reduction, G. metallireducens atpB may contain adaptations for functioning in environments with variable redox potentials, potentially including additional cysteine residues or metal-coordination sites not present in aerobic organisms.

  • Interaction interfaces: The regions interacting with other ATP synthase subunits show organism-specific variations that reflect co-evolution within the Geobacter ATP synthase complex. These differences may impact assembly pathways and stability of the complex .

  • Post-translational modifications: The pattern of potential modifications may differ from those in model organisms, reflecting the unique regulatory mechanisms in Geobacter species.

When designing experiments with recombinant G. metallireducens atpB, these differences should be considered, particularly when using heterologous expression systems or attempting to create hybrid complexes.

How should researchers troubleshoot expression and purification issues with recombinant G. metallireducens atpB?

Table 4: Common Problems and Solutions in G. metallireducens atpB Production

ProblemPossible CausesTroubleshooting ApproachesPrevention Strategies
Low expressionToxicity to host cellsUse C41/C43 strains designed for toxic proteinsEmploy tightly regulated promoters
Codon biasOptimize codons for expression hostUse codon-optimized synthetic gene
mRNA instabilityCheck for RNase sites in sequenceAdd stabilizing elements to 5' UTR
Inclusion body formationImproper foldingLower induction temperature (16-18°C)Co-express chaperones (GroEL/ES)
Too rapid expressionReduce inducer concentrationUse auto-induction media
Insufficient membrane spaceExpress with other ATP synthase subunitsUse host with expanded membrane capacity
Poor solubilizationInadequate detergentScreen detergent panel (DDM, LMNG, etc.)Optimize detergent:protein ratio
Improper buffer conditionsAdjust pH and ionic strengthInclude stabilizing additives
Aggregation during extractionAdd glycerol and reducing agentsMaintain low temperature during process
Low purityNon-specific bindingOptimize imidazole concentration in wash buffersConsider dual affinity tags
DegradationAdd protease inhibitorsMinimize purification time
Contaminant proteinsAdd secondary purification stepsUse size exclusion as final step
Inactive proteinDenaturation during purificationValidate folding with spectroscopic methodsMaintain native-like environment
Critical lipid lossAdd specific lipids during purificationConsider nanodisc reconstitution
Improper disulfide formationControl redox environmentInclude reducing agents appropriately

Additional recommendations:

  • Document every variable in initial trials to identify critical parameters

  • Implement small-scale tests before scaling up production

  • Consider fusion partners (MBP, SUMO) that can enhance solubility

  • Validate protein identity at multiple purification stages using mass spectrometry

What are the latest analytical techniques for studying the structure-function relationship of G. metallireducens atpB?

Recent advances in analytical methods provide new opportunities for investigating G. metallireducens atpB:

  • Cryo-electron tomography:

    • Enables visualization of ATP synthase in near-native cellular contexts

    • Can reveal the organization of ATP synthase dimers and oligomers in the membrane

    • Requires thin samples, achievable through cryo-FIB milling of bacterial cells

  • Single-molecule techniques:

    • Fluorescence correlation spectroscopy (FCS) to measure diffusion properties in membranes

    • Single-molecule FRET to track conformational changes during function

    • Magnetic tweezers to directly measure rotational torque in reconstituted ATP synthase complexes

  • Mass spectrometry advancements:

    • Native mass spectrometry of membrane protein complexes using specialized detergents or nanodiscs

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational dynamics

    • Crosslinking mass spectrometry to determine proximity relationships between subunits

    • Protein footprinting methods (such as FPOP) to probe solvent-accessible surfaces

  • Advanced spectroscopic methods:

    • Solid-state NMR of reconstituted systems to determine structural constraints

    • EPR spectroscopy with site-directed spin labeling to measure distances and dynamics

    • Time-resolved infrared spectroscopy to monitor proton transfer events

  • Computational approaches:

    • Molecular dynamics simulations of atpB in lipid bilayers

    • Coarse-grained modeling to study assembly processes

    • Quantum mechanics/molecular mechanics (QM/MM) calculations for proton transfer mechanisms

Combining these techniques provides complementary information that can be integrated to develop comprehensive structure-function models of G. metallireducens atpB and its role in the ATP synthase complex.

How does recombinant G. metallireducens atpB contribute to synthetic biology applications in bioremediation?

Recombinant G. metallireducens atpB holds significant potential for synthetic biology applications in bioremediation:

  • Engineered bioremediation systems: Recombinant atpB with enhanced proton translocation efficiency could be incorporated into synthetic microorganisms designed for metal reduction. By optimizing energy conservation, these engineered systems could achieve faster rates of metal reduction, similar to the enhanced respiration observed in G. sulfurreducens with modified ATP synthase .

  • Biosensor development: atpB variants can be engineered as components of whole-cell biosensors for monitoring environmental conditions relevant to bioremediation. For example, fusion proteins combining atpB with fluorescent reporters could provide real-time information on membrane potential or proton gradient formation during bioremediation processes.

  • Minimal genome approaches: As part of efforts to create streamlined Geobacter strains for bioremediation, understanding the essential features of atpB allows for rational genome reduction while maintaining key metabolic capabilities.

  • Cross-species functional modules: Engineered atpB could be part of transferable genetic modules that confer metal-reducing capabilities to non-Geobacter hosts. This approach requires understanding the compatibility between ATP synthase components from different organisms and developing strategies to ensure proper assembly .

  • Adaptive laboratory evolution platforms: Systems incorporating recombinant atpB can serve as starting points for directed evolution of enhanced bioremediation capabilities, similar to approaches used to improve G. sulfurreducens lactate metabolism .

By applying synthetic biology principles to G. metallireducens atpB, researchers can develop novel approaches to persistent environmental challenges in metal-contaminated sites.

What emerging technologies might enhance our understanding of G. metallireducens atpB function in renewable energy applications?

Several emerging technologies show promise for advancing our understanding of G. metallireducens atpB in renewable energy contexts:

  • Advanced bioelectrochemical interfaces:

    • Nanostructured electrodes with precise surface chemistry to study direct electron transfer

    • Real-time, in situ spectroelectrochemistry to monitor redox states during electron transfer

    • Microfluidic electrochemical cells for high-throughput screening of atpB variants

  • Synthetic biology tools for Geobacter:

    • CRISPR-Cas9 genome editing systems optimized for G. metallireducens

    • Inducible promoter systems for precise control of atpB expression

    • Cell-free expression systems derived from Geobacter for rapid prototyping

  • Advanced imaging approaches:

    • Single-molecule localization microscopy to track ATP synthase distribution and dynamics

    • Correlative light and electron microscopy to link function with ultrastructure

    • Expansion microscopy to visualize protein complexes at enhanced resolution

  • High-resolution temporal analysis:

    • Time-resolved structural methods (TR-XFELs, TR-EM) to capture transient states

    • Millisecond-scale metabolomics to link ATP synthase activity with metabolic responses

    • Real-time imaging of membrane potential using improved voltage-sensitive probes

  • Computational advances:

    • Machine learning approaches to predict functional properties from sequence

    • Quantum computing applications for modeling electron transfer processes

    • Digital twins of G. metallireducens to simulate system-wide effects of atpB modifications

These technologies, especially when combined in integrative approaches, could dramatically advance our understanding of how ATP synthase components like atpB contribute to Geobacter's remarkable capabilities in bioelectrochemical systems and guide rational engineering for enhanced renewable energy applications.

How can insights from G. metallireducens atpB research be applied to developing improved microbial fuel cells?

Research on G. metallireducens atpB provides several translational pathways for improving microbial fuel cell (MFC) technology:

  • Enhanced energy conservation:

    • Engineered atpB variants with optimized proton/ATP ratios could improve the balance between cellular energy needs and extracellular electron transfer

    • Strategic modifications to increase ATP synthase efficiency would allow cells to maintain viability while diverting more electrons to electrodes

    • Similar to approaches that increased respiration rates in G. sulfurreducens , atpB engineering could enhance power output in MFCs

  • Improved stability and longevity:

    • Understanding the structural determinants of atpB stability can guide the development of MFC biocatalysts with extended operational lifetimes

    • Engineered ATP synthase complexes with enhanced thermostability could expand MFC applications to more extreme environments

    • Preventing degradation of ATP synthase under long-term operation would maintain consistent power output

  • Optimized biofilm formation:

    • ATP synthase activity influences cellular energetics, which in turn affects biofilm development

    • Strategic regulation of atpB expression could promote the formation of electrochemically active biofilms with enhanced conductivity

    • Understanding the relationship between ATP synthase dimerization and membrane architecture could inform strategies to optimize electrode-biofilm interfaces

  • Adaptive response engineering:

    • Knowledge of how atpB influences cellular responses to environmental changes can guide the development of self-regulating MFC systems

    • Similar to the adaptive capacity seen in evolved G. sulfurreducens strains , engineered regulatory circuits involving atpB could enable dynamic optimization of MFC performance

  • System-level integration:

    • Insights from atpB research inform the metabolic network modeling necessary for rational whole-cell engineering

    • Understanding the interplay between ATP synthesis and electron transfer pathways enables holistic optimization approaches rather than targeting single components

These applications demonstrate how fundamental research on G. metallireducens atpB translates to practical improvements in sustainable energy technologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.