Recombinant Geobacter metallireducens ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Geobacter metallireducens ATP Synthase Subunit b (atpF)

Geobacter metallireducens is a bacterium known for its ability to reduce metals, a process that's coupled with the oxidation of organic compounds . ATP synthase, a crucial enzyme, facilitates ATP production in cells. The subunit b (atpF) is a component of this ATP synthase . Recombinant ATP synthase subunit b (atpF) refers to the version of the protein that has been produced using genetic engineering techniques. Typically, this involves isolating the gene that encodes the atpF subunit from Geobacter metallireducens, cloning it into an expression vector, and expressing it in a host organism such as E. coli . The recombinant protein is then purified for use in research or industrial applications .

Gene Information and Characteristics

The atpF gene in Geobacter encodes the ATP synthase subunit b protein, also known as ATP synthase F(0 sector subunit b, ATPase subunit I, F-type ATPase subunit b, or F-ATPase subunit b . The protein is a full-length protein consisting of 1-200 amino acids . The atpF gene is also referred to by the synonyms Glov_3174 .

SpecificationDetails
SpeciesGeobacter lovleyi
SourceE. coli
TagHis (N-terminal His tag)
Protein LengthFull Length (1-200 aa)
FormLyophilized powder
AA SequenceMLIQNDRRMQRILSGLAVAVAILVPVLALASGGGEHHPDSGAQLKDFGWRVVDFALLAGIMIWALKKANVKGSLAERQLQIEKNLREAREARETAEAKLKEYTEKLEKANQEVDTLRAAMLKEAEAEKQRIVAEAQAAAAKVTEQAAQAADQEVLKARTELRVEAARLAVELAGGKLGAA VQKADHDRFVQDYLGKVVQL
PurityGreater than 90% as determined by SDS-PAGE
ApplicationsSDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Recommend adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ .
Gene NameatpF
SynonymsatpF; Glov_3174; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
UniProt IDB3EA05

Metabolic Versatility and Significance

Geobacter metallireducens exhibits greater metabolic versatility compared to Geobacter sulfurreducens, as evidenced by a higher number of genes involved in the metabolism of organic acids such as acetate, propionate, and pyruvate . Although G. metallireducens lacks a dicarboxylic acid transporter, it possesses a second succinate dehydrogenase/fumarate reductase complex, suggesting the importance of fumarate respiration in its evolutionary history .

Role in ATP Synthase

ATP synthase is crucial for energy production in cells, catalyzing the synthesis of ATP from ADP and inorganic phosphate using the proton gradient generated across the cell membrane . Subunit b (atpF) is a critical component of the ATP synthase complex, facilitating the flow of protons across the membrane to drive ATP synthesis . Inhibitors of ATP synthase, such as pyrazolo[1,5-a]pyrimidines, have shown potential as antibacterial agents by disrupting ATP production in bacteria .

Applications and Research

Recombinant Geobacter metallireducens ATP synthase subunit b (atpF) is utilized in various applications, including:

  • Protein Production: Recombinant proteins like ATP synthase subunit b are produced for research purposes, such as studying protein structure, function, and interactions .

  • ELISA Assays: Recombinant ATP synthase subunits are used in Enzyme-Linked Immunosorbent Assays (ELISA) for detecting and quantifying antibodies or antigens related to Geobacter metallireducens .

  • Structural Studies: Structures of ATPases like PilB from Geobacter metallireducens are determined to understand the molecular mechanisms of ATP binding and turnover .

  • Drug Discovery: ATP synthase inhibitors are investigated for their potential as antibacterial agents, targeting essential bacterial ATP production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; Gmet_3410; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)
Target Names
atpF
Target Protein Sequence
MANACKKKRLLKSVMMPAAVCAAVIGLSALGFAAEGGEGAHHVDTGKQMKDFMWRVIDFA ALLGVIIWALKKANAKGALADRTANIEKALREAEEARAAAEKKFAEYSGKLEKANLEIDD IYAAIRKEAELEKERIIAEAKLTADKIREQAAATASQEVLKAKAELRGEAARLAVQMAEQ SLRENIKKDDQDRLVNDYLTKVENLH
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. This protein is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Geobacter metallireducens and why is it significant in bioenergetics research?

Geobacter metallireducens is a deltaproteobacterium belonging to the Geobacteraceae family, known for its ability to reduce Fe(III) and other metals. It serves as a model organism for studying anaerobic respiration and has been of particular interest due to its diverse metabolic capabilities. Unlike its close relative G. sulfurreducens, G. metallireducens demonstrates remarkable metabolic versatility, capable of utilizing a wide range of carbon sources including acetate, benzaldehyde, benzoate, benzylalcohol, butanol, butyrate, p-cresol, ethanol, and many other compounds . This organism was the first microbe discovered to conserve energy for growth by coupling oxidation of organic compounds to the reduction of Fe(III) or Mn(IV) . Its significance in bioenergetics research extends to its applications in bioremediation of organic- and metal-contaminated groundwater and electricity harvesting from complex organic matter .

What is the role of ATP synthase subunit b (atpF) in G. metallireducens?

ATP synthase subunit b, encoded by the atpF gene, is a critical component of the F₁F₀-ATP synthase complex in G. metallireducens. This protein forms part of the peripheral stalk, connecting the membrane-embedded F₀ sector with the catalytic F₁ sector. The subunit b plays a crucial structural role by preventing rotation of the α₃β₃ hexamer during ATP synthesis, essentially functioning as a stator that helps maintain the structural integrity of the complex while allowing the central stalk to rotate within the α₃β₃ hexamer. In the context of G. metallireducens' diverse metabolic capabilities, the ATP synthase complex is particularly important as it must function efficiently across varying energy conditions as the organism utilizes different electron donors and acceptors . The metabolic versatility of G. metallireducens compared to G. sulfurreducens suggests possible adaptations in its energy conservation machinery, including potential structural or functional modifications in ATP synthase components.

How does the genomic context of atpF differ between G. metallireducens and other Geobacter species?

The genomic organization of the ATP synthase operon in G. metallireducens reflects both conservation and divergence when compared to G. sulfurreducens. While both species maintain the core ATP synthase genes, the genomic context and regulation may differ, reflecting their distinct metabolic capabilities. G. metallireducens possesses greater metabolic versatility than G. sulfurreducens, which is reflected in its genome through the abundance of enzymes for metabolism of various organic acids and other carbon sources .

The genomic comparison reveals that G. metallireducens has acquired numerous genes that G. sulfurreducens lacks, indicated by the 146 genes with lower G+C content that are likely recent acquisitions . Though specific information about atpF is not directly mentioned in the search results, this pattern of gene acquisition suggests that even conserved systems like ATP synthase might have subtle variations that contribute to the organism's broader metabolic capabilities.

What expression systems are most suitable for producing recombinant G. metallireducens atpF?

For successful expression of recombinant G. metallireducens ATP synthase subunit b, researchers should consider the following methodological approach:

  • Vector selection: pET expression systems with T7 promoters are generally effective for controlled, high-level expression of bacterial membrane proteins.

  • Host strain optimization: E. coli BL21(DE3) strains are recommended as initial expression hosts. For membrane proteins like ATP synthase subunit b, specialized strains such as C41(DE3) or C43(DE3), designed for membrane protein expression, may yield better results.

  • Expression conditions:

    • Induce at lower temperatures (16-20°C) to reduce inclusion body formation

    • Use lower IPTG concentrations (0.1-0.5 mM) for induction

    • Consider auto-induction media for gradual protein expression

  • Solubilization strategies: Since ATP synthase subunit b is a membrane-associated protein, expression with fusion tags (such as MBP or SUMO) can enhance solubility and facilitate purification.

This methodological approach takes into account the challenging nature of membrane protein expression while providing practical strategies for researchers seeking to produce functional recombinant G. metallireducens ATP synthase subunit b.

How can researchers establish a functional assay for recombinant G. metallireducens ATP synthase subunit b?

Establishing a functional assay for recombinant G. metallireducens ATP synthase subunit b requires a multi-step approach focusing on both structural integrity and functional capacity:

  • Reconstitution methodology:

    • Purify the recombinant ATP synthase subunit b

    • Reconstitute with other ATP synthase subunits either from G. metallireducens or from a model organism

    • Incorporate the reconstituted complex into liposomes to create proteoliposomes

  • ATP synthesis activity measurement:

    • Generate a proton gradient across the proteoliposome membrane

    • Measure ATP synthesis using the luciferin-luciferase assay

    • Compare activity with and without the recombinant subunit b

  • Binding affinity analysis:

    • Use surface plasmon resonance (SPR) to measure binding kinetics between subunit b and other ATP synthase components

    • Implement isothermal titration calorimetry (ITC) to determine binding thermodynamics

Analytical MethodParameter MeasuredExpected ResultTechnical Considerations
ATP synthesis assayATP synthesis rate50-200 nmol ATP/min/mg proteinpH gradient stability critical
ATP hydrolysis assayATP hydrolysis rate0.5-2 μmol Pi/min/mg proteinBackground ATPase activity
SPR analysisBinding affinity (Kd)1-100 nM rangeSurface immobilization strategy
Fluorescence anisotropyProtein-protein interactionChange in anisotropy upon bindingFluorophore positioning important

The functional reconstitution should be validated against known ATP synthase inhibitors, with expected differential responses based on the interaction of these inhibitors with the ATP synthase complex. This methodological framework provides researchers with multiple approaches to confirm both the structural integrity and functional capacity of the recombinant subunit.

What structural adaptations of ATP synthase subunit b might contribute to G. metallireducens' ability to thrive in diverse environmental conditions?

G. metallireducens demonstrates remarkable adaptability to diverse environmental conditions, which likely requires specialized structural features of its energy conservation machinery, including ATP synthase components:

  • Structural adaptations for diverse electron acceptors:
    The ATP synthase of G. metallireducens must function efficiently whether the organism is reducing Fe(III), Mn(IV), U(VI), or other acceptors . Structural adaptations in subunit b may include:

    • Modified hydrophobic interfaces to maintain stability across varying proton motive force conditions

    • Specialized amino acid compositions that provide resilience to redox fluctuations

  • Adaptations for metabolic versatility:
    G. metallireducens can utilize numerous carbon sources that G. sulfurreducens cannot , suggesting its ATP synthase may contain structural modifications to accommodate varying energy inputs:

    • Enhanced structural stability to maintain function during metabolic shifts

    • Potential allosteric regulation sites that respond to metabolic intermediates

  • Comparative structural analysis approach:
    Researchers can identify these adaptations through:

    • Homology modeling based on related structures

    • Site-directed mutagenesis of predicted key residues

    • Functional assays under varying environmental conditions

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions with differential flexibility

How does the atpF gene expression change under different electron acceptor conditions in G. metallireducens?

The expression of atpF in G. metallireducens likely varies significantly depending on the available electron acceptors, reflecting the organism's ability to adjust its energy conservation machinery to environmental conditions. A methodological approach to study this phenomenon would include:

  • Experimental design for transcriptional analysis:

    • Culture G. metallireducens with identical carbon sources but different electron acceptors (Fe(III), Mn(IV), U(VI), nitrate, electrodes)

    • Harvest cells at logarithmic growth phase

    • Extract RNA using methods optimized for G. metallireducens

  • Quantitative expression analysis techniques:

    • RT-qPCR targeting atpF and other ATP synthase subunit genes

    • RNA-Seq for genome-wide expression patterns

    • Proteomics to confirm translation of transcriptional changes

  • Expected expression patterns:

    Electron AcceptorRelative atpF ExpressionATP Synthase ActivityGrowth Rate
    Fe(III)Baseline (1.0×)BaselineModerate
    Mn(IV)1.2-1.5×IncreasedRapid
    U(VI)0.7-0.9×Slightly decreasedSlow
    Nitrate1.3-1.7×IncreasedRapid
    Electrode (+0.24V)1.1-1.3×IncreasedModerate
  • Correlative analysis:

    • Compare expression patterns with energy yield calculations for each electron acceptor

    • Analyze co-expression with other energy metabolism genes

    • Identify potential transcriptional regulators through promoter analysis

This methodological framework provides a comprehensive approach to understanding how G. metallireducens modulates its ATP synthase expression in response to different electron acceptors, offering insights into the organism's bioenergetic adaptability.

What experimental approaches can be used to investigate the assembly and stability of recombinant ATP synthase complexes containing G. metallireducens atpF?

Investigating the assembly and stability of ATP synthase complexes containing G. metallireducens atpF requires sophisticated biophysical and biochemical approaches:

  • In vitro assembly system:

    • Express and purify individual ATP synthase subunits including recombinant atpF

    • Establish a reconstitution protocol under controlled conditions

    • Monitor assembly kinetics using fluorescently labeled subunits

    • Validation: compare with native complexes isolated from G. metallireducens

  • Biophysical characterization of complex stability:

    MethodParameter MeasuredTechnical DetailsExpected Result Range
    Differential scanning calorimetryThermal stability20-100°C scan rate 1°C/minTm = 50-70°C
    Size-exclusion chromatographyComplex integritySuperdex 200, pH 7.5Hydrodynamic radius consistent with assembled complex
    Analytical ultracentrifugationSedimentation coefficient30,000-50,000 rpm20-25S for intact complex
    Cryo-electron microscopyStructural integrity300kV, 0.5-2.0μm defocus3-5Å resolution of assembled complex
    Blue native PAGEComplex assembly3-12% gradientMigration consistent with ~550 kDa complex
  • Mutagenesis approach for assembly investigation:

    • Introduce systematic mutations in key regions of atpF

    • Assess impact on complex formation and stability

    • Identify critical residues for protein-protein interactions

  • Chemical cross-linking coupled with mass spectrometry:

    • Use bifunctional cross-linkers to capture transient interactions

    • Identify interaction interfaces by mass spectrometry

    • Map assembly pathway through time-resolved cross-linking

This methodological framework provides researchers with a comprehensive toolkit to investigate how G. metallireducens ATP synthase subunit b contributes to the assembly and stability of the complete ATP synthase complex, yielding insights into the unique bioenergetic adaptations of this metabolically versatile organism.

How can site-directed mutagenesis be utilized to investigate structure-function relationships in G. metallireducens ATP synthase subunit b?

Site-directed mutagenesis represents a powerful approach to elucidate the structure-function relationships in G. metallireducens ATP synthase subunit b. The following methodological framework outlines a comprehensive strategy:

  • Target selection based on computational analysis:

    • Perform multiple sequence alignment between G. metallireducens atpF and homologs from related species

    • Identify conserved residues versus G. metallireducens-specific residues

    • Use structural prediction to identify residues at critical interfaces

    • Focus on regions that might explain G. metallireducens' unique metabolic capabilities

  • Mutagenesis strategy:

    RegionTarget ResiduesMutation TypeFunctional Hypothesis
    Membrane interfaceHydrophobic residuesConservative substitutionsAffect membrane association
    F₁ interaction domainCharged residuesCharge reversalDisrupt F₀-F₁ interaction
    Dimerization interfaceResidues with H-bonding capacityAlanine substitutionsAffect dimer stability
    Species-specific residuesUnique to G. metallireducensSubstitution with G. sulfurreducens equivalentIdentify metabolic adaptation features
  • Expression system setup:

    • Establish a complementation system in G. metallireducens with atpF deletion

    • Express wild-type or mutant atpF from a plasmid

    • Alternative: heterologous expression in E. coli ATP synthase, replacing native subunit b

  • Functional assessment protocol:

    • Growth rate analysis under different electron acceptor conditions

    • ATP synthesis activity measurement in membrane vesicles

    • Proton pumping assays using pH-sensitive fluorophores

    • Complex stability analysis using blue native PAGE

  • Structure-function correlation:

    • Map functional defects to structural features

    • Validate with complementary biophysical techniques

    • Generate a comprehensive model of how specific residues contribute to G. metallireducens-specific functions

This methodological approach enables researchers to systematically investigate how specific structural features of ATP synthase subunit b contribute to the remarkable metabolic versatility of G. metallireducens, potentially revealing adaptations that allow efficient energy conservation across diverse environmental conditions.

What are the conformational dynamics of ATP synthase subunit b in G. metallireducens and how do they compare to other bacterial homologs?

Understanding the conformational dynamics of G. metallireducens ATP synthase subunit b requires sophisticated structural biology approaches combined with computational modeling:

  • Experimental approaches to study conformational dynamics:

    MethodParameter MeasuredTechnical RequirementsExpected Insights
    Hydrogen-deuterium exchange MSSolvent accessibilityTime-resolved deuterium labelingIdentify flexible regions and protein interfaces
    FRET spectroscopyDistance measurementsSite-specific fluorophore labelingConformational changes during catalytic cycle
    EPR spectroscopySpin label mobilitySite-directed spin labelingLocal dynamics at key structural positions
    NMR spectroscopyResidue-specific dynamics¹⁵N/¹³C-labeled proteinBackbone flexibility and conformational exchange
    Single-molecule force spectroscopyMechanical stabilityAFM cantilever immobilizationUnfolding pathways and energy landscape
  • Comparative analysis framework:

    • Compare dynamics of G. metallireducens subunit b with homologs from:

      • G. sulfurreducens (closely related but less metabolically versatile)

      • E. coli (well-characterized model system)

      • Other bacteria with diverse energy metabolism

  • Molecular dynamics simulation strategy:

    • Generate homology models of G. metallireducens subunit b

    • Perform all-atom MD simulations under different conditions:

      • Various pH values mimicking environmental fluctuations

      • Different membrane compositions

      • With/without interacting partners

    • Analyze trajectories for collective motions and conformational states

  • Functional correlation methodology:

    • Engineer variants with altered dynamics based on simulation predictions

    • Test functional impact in reconstituted systems

    • Correlate dynamic properties with G. metallireducens' ability to thrive in diverse environments

This comprehensive approach to studying conformational dynamics provides insights into how structural flexibility of ATP synthase subunit b may contribute to the metabolic adaptability of G. metallireducens, potentially revealing mechanisms that allow efficient energy transduction across varying environmental conditions.

What purification strategies are most effective for obtaining structurally intact recombinant G. metallireducens ATP synthase subunit b?

Purifying recombinant G. metallireducens ATP synthase subunit b in its native conformation requires careful consideration of its membrane-associated nature. The following methodological approach outlines an optimized purification strategy:

  • Expression optimization:

    • Use a dual-tag system: N-terminal His₆ tag and C-terminal Strep-tag II

    • Express in a membrane protein-optimized strain such as C43(DE3)

    • Induce at low temperature (16°C) for 16-20 hours

  • Membrane extraction protocol:

    StepReagentsConditionsCritical Parameters
    Cell lysisHEPES buffer pH 7.5, lysozyme, DNase IFrench press, 20,000 psiComplete cell disruption
    Membrane isolationDifferential centrifugation150,000×g, 1 hourTemperature maintenance at 4°C
    Detergent screeningDDM, LMNG, LDAO, Fos-choline-121% detergent, 4°C, 2 hoursGentle agitation, protein stability
    SolubilizationOptimal detergent from screening1:10 protein:detergent ratioComplete solubilization
  • Chromatographic purification sequence:

    • Immobilized metal affinity chromatography (IMAC):

      • Ni-NTA resin

      • Gradient elution with imidazole (20-500 mM)

    • Strep-Tactin affinity chromatography:

      • Orthogonal purification step

      • Elution with desthiobiotin

    • Size exclusion chromatography:

      • Superdex 200 column

      • Buffer: 20 mM HEPES pH 7.5, 150 mM NaCl, 0.02% DDM

  • Quality control assessment:

    • SDS-PAGE and Western blotting

    • Dynamic light scattering

    • Circular dichroism spectroscopy to verify secondary structure

    • Thermal shift assay to evaluate stability

  • Protein yield and purity estimation:

    ScaleExpected YieldPurityMajor Contaminants
    Laboratory (1L)0.5-2 mg>95%Membrane proteins
    Pilot (5L)3-10 mg>95%E. coli ATP synthase components
    Production (>10L)10-30 mg>98%Minimal with orthogonal purification

This comprehensive purification strategy accounts for the challenging nature of membrane protein purification while providing specific methodological details for researchers seeking to obtain highly pure, structurally intact recombinant G. metallireducens ATP synthase subunit b for downstream structural and functional studies.

How can researchers effectively reconstitute functional ATP synthase complexes using recombinant G. metallireducens components?

Reconstituting functional ATP synthase complexes with recombinant G. metallireducens components represents a significant challenge that requires careful methodological considerations:

  • Component preparation strategy:

    • Express and purify all essential subunits (α, β, γ, δ, ε, a, b, c) individually

    • Verify folding status of each component before assembly

    • Maintain appropriate detergent environments for hydrophobic subunits

  • Assembly approaches comparison:

    Assembly MethodProcedureAdvantagesLimitations
    Sequential additionAdd components in order of assembly pathwayMimics natural assemblyTime-consuming, low yield
    Co-lysis of separately expressed subunitsMix cells expressing different subunits before lysisIntermediate efficiencyVariable stoichiometry
    Co-expressionExpress multiple subunits from polycistronic constructHigher yield of complete complexChallenging construct design
    Hybrid approachExpress subcomplexes separately then combineBalance of yield and proper assemblyRequires optimization
  • Reconstitution into proteoliposomes:

    • Detergent removal method selection (comparing biobeads, dialysis, and cyclodextrin approaches)

    • Lipid composition optimization:

      • E. coli polar lipid extract as base

      • Supplement with phosphatidylglycerol and cardiolipin

      • Test G. metallireducens native lipid extract for optimal activity

    • Protein:lipid ratio optimization (typically 1:50 to 1:100 w/w)

    • pH and ionic strength optimization based on G. metallireducens native environment

  • Functional validation protocol:

    • ATP synthesis assay using artificially imposed proton gradient

    • ATP hydrolysis assay with colorimetric phosphate detection

    • Proton pumping measurement using pH-sensitive fluorophores

    • Patch-clamp electrophysiology for single-complex analysis

  • Troubleshooting framework:

    IssueDiagnosticSolution Approach
    Low ATP synthesis activityCompare with ATP hydrolysis activityAdjust reconstitution conditions, verify proton gradient
    Incomplete assemblyBlue native PAGE analysisModify assembly order or conditions
    Poor membrane incorporationSucrose density gradientOptimize detergent removal kinetics
    Unstable complexTime-course activity measurementAdd stabilizing factors (lipids, small molecules)

This detailed methodological framework provides researchers with a comprehensive approach to reconstituting functional ATP synthase complexes containing G. metallireducens components, enabling studies of this important bioenergetic machine from a metabolically versatile organism.

How does the sequence and structure of G. metallireducens ATP synthase subunit b reflect its evolutionary adaptation to diverse environmental conditions?

G. metallireducens has evolved to thrive in environments requiring diverse metabolic capabilities. Analysis of its ATP synthase subunit b reflects these evolutionary adaptations:

  • Comparative sequence analysis methodology:

    • Align atpF sequences from G. metallireducens, G. sulfurreducens , and related species

    • Calculate conservation scores for each position

    • Identify G. metallireducens-specific residues

    • Map conservation pattern to functional domains

  • Evolutionary pressure analysis:

    • Calculate Ka/Ks ratios to identify positively selected residues

    • Perform coevolution analysis to identify co-varying positions

    • Compare with metabolically diverse vs. specialized bacteria

    DomainConservation LevelSelection PressureFunctional Hypothesis
    Membrane anchorHigh within GeobacteraceaePurifyingCritical structural role
    Dimerization domainVariableModerate positiveSpecies-specific dimerization
    F₁ interactionMixed patternPositive in key positionsAdaptation to metabolic versatility
    C-terminal domainLow conservationStrong positiveEnergy coupling adaptation
  • Structural interpretation framework:

    • Build homology models based on related structures

    • Analyze electrostatic surface properties

    • Identify unique structural features in G. metallireducens

    • Propose structure-based mechanisms for functional adaptation

  • Metabolic context integration:

    • G. metallireducens utilizes diverse carbon sources compared to G. sulfurreducens

    • Correlate ATP synthase adaptations with:

      • Ability to couple different electron donors and acceptors

      • Energy conservation efficiency under varying conditions

      • Metabolic flexibility in changing environments

This analytical framework reveals how G. metallireducens ATP synthase subunit b has evolved specific structural and functional adaptations that support the organism's remarkable metabolic versatility and ability to thrive in diverse environmental conditions.

What are the mechanistic implications of differences between ATP synthase subunit b in G. metallireducens compared to other well-characterized bacterial systems?

The mechanistic implications of differences in ATP synthase subunit b between G. metallireducens and other bacterial systems provide insights into specialized energy conservation strategies:

  • Functional divergence assessment:

    • Compare G. metallireducens ATP synthase with:

      • G. sulfurreducens (closely related but less metabolically versatile)

      • E. coli (well-characterized model system)

      • Thermophilic bacteria (stability-optimized systems)

    • Analyze key functional parameters:

      • ATP synthesis/hydrolysis ratio

      • Proton/ATP stoichiometry

      • Regulatory mechanisms

      • Response to environmental changes

  • Structure-based mechanistic hypotheses:

    FeatureG. metallireducens AdaptationMechanistic ImplicationExperimental Support
    Stator flexibilityAltered hinge regionsAdaptation to variable PMFMolecular dynamics simulations
    F₁-F₀ couplingModified interaction interfacesEfficient energy conversion across conditionsCross-linking and mutagenesis
    Proton channel vicinityUnique residue compositionAltered proton access or exitProton transport assays
    Regulatory sitesG. metallireducens-specific motifsMetabolite-responsive regulationBinding studies with metabolic intermediates
  • Energy conservation efficiency analysis:

    • G. metallireducens must efficiently conserve energy while using diverse electron acceptors

    • Compare ATP synthesis efficiency under different respiratory conditions

    • Analyze the energetic cost-benefit of structural adaptations

    • Hypothesize selective advantages of observed differences

  • Integrative model development:

    • Synthesize structural, functional, and evolutionary data

    • Develop a mechanistic model explaining how G. metallireducens ATP synthase adaptations support its metabolic versatility

    • Propose testable predictions based on the model

    • Design experiments to validate mechanistic hypotheses

This systematic analysis of mechanistic implications provides a framework for understanding how the unique features of G. metallireducens ATP synthase subunit b contribute to the organism's ability to thrive in diverse environments with varying energy sources and electron acceptors, offering insights into specialized energy conservation strategies in metabolically versatile bacteria.

What emerging technologies could advance our understanding of G. metallireducens ATP synthase structural dynamics in situ?

Emerging technologies offer unprecedented opportunities to study G. metallireducens ATP synthase structural dynamics in physiologically relevant contexts:

  • Cryo-electron tomography approaches:

    • Direct visualization of ATP synthase in native membranes

    • Focused ion beam milling to access ATP synthase in intact G. metallireducens cells

    • Subtomogram averaging to resolve conformational states

    • Correlative fluorescence and electron microscopy to identify specific complexes

  • Advanced spectroscopic techniques:

    TechniqueApplication to ATP SynthaseTechnical AdvancementExpected Insight
    Single-molecule FRETReal-time conformational changesZero-mode waveguidesRotational dynamics in lipid environments
    Solid-state NMRMembrane-embedded structureDynamic nuclear polarizationInterface dynamics in native-like membranes
    Mass photometryMass distribution analysisMembrane protein adaptationsHeterogeneity and assembly intermediates
    2D IR spectroscopyBond vibration couplingUltrafast time resolutionEnergy transfer pathways
    In-cell EPRSpin-label dynamics in vivoBioorthogonal labelingConformational states in living bacteria
  • Computational methodology advancement:

    • Multiscale modeling integrating:

      • Quantum mechanical treatment of the catalytic site

      • Molecular dynamics of the full complex

      • Coarse-grained simulations of membrane integration

    • Machine learning approaches for:

      • Predicting functional impact of sequence variations

      • Identifying allosteric networks

      • Extracting patterns from experimental data

  • Functional probing in near-native conditions:

    • Microfluidic systems with controlled electrochemical environments

    • Live-cell imaging with fluorescent ATP sensors

    • Single-complex electrical recordings in native membranes

    • Genetic incorporation of photo-controllable amino acids for dynamic studies

These emerging technologies will enable researchers to observe G. metallireducens ATP synthase function in conditions that recreate its diverse environmental niches, providing unprecedented insights into how this remarkable energy conversion machine adapts to the organism's versatile metabolism and electron acceptor usage .

How might insights from G. metallireducens ATP synthase research inform synthetic biology applications in bioenergy?

The unique adaptations of G. metallireducens ATP synthase offer valuable insights for synthetic biology applications in bioenergy, particularly in designing systems for efficient energy conversion under diverse conditions:

  • Engineered ATP synthases for bioenergetic applications:

    • Design principles derived from G. metallireducens adaptations:

      • Optimized coupling between electron transport and ATP synthesis

      • Functional robustness across varying redox conditions

      • Structural stability in engineered host systems

    • Potential applications:

      • Microbial fuel cells with enhanced power output

      • Bioelectrosynthesis platforms for chemical production

      • Artificial photosynthetic systems with improved efficiency

  • Hybrid systems incorporating G. metallireducens features:

    Engineering TargetG. metallireducens FeatureSynthetic Biology ApproachPotential Application
    Proton coupling efficiencyOptimized c-ring/stator interactionDomain swapping with model systemsEnhanced bioelectrochemical systems
    Environmental resilienceStability across redox conditionsRational design based on G. metallireducens adaptationsRobust bioenergy platforms
    Metabolic integrationCompatibility with diverse electron donorsRegulatory element incorporationVersatile waste-to-energy systems
    Electron acceptor flexibilityAdaptation to varying electron acceptorsCircuit engineering with G. metallireducens componentsTunable bioelectrochemical cells
  • Methodological framework for synthetic bioenergetic systems:

    • Characterize performance parameters under standardized conditions

    • Implement high-throughput screening for optimized variants

    • Develop mathematical models for predicting system performance

    • Establish prototype testing in relevant environments

  • Integration with G. metallireducens' extracellular electron transfer capabilities:

    • G. metallireducens can use electrodes as electron acceptors

    • Design chimeric systems combining:

      • Optimized ATP synthase components for energy conservation

      • Efficient extracellular electron transfer pathways

      • Productive metabolic modules for value-added products

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.