Recombinant Geobacter metallireducens Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for you.
Synonyms
plsY; Gmet_3020; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-194
Protein Length
full length protein
Species
Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)
Target Names
plsY
Target Protein Sequence
MLIEILLLAGAYLLGSIPTGLLLAKAAGVDIRTTGSGNIGATNVYRTLGRSVGIATLVGD CLKGLIPVLAAKYLGMTDLWIALAGLAAFLGHVYTVFLGFKGGKGVATALGVFLGLAPLA VLIALGIFVAVVATSRYISLGSITAAAAMPPVVAFLSGRPPLVGVTVVIALLVIWKHREN IQRLRAGTENRFKA
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of glycerol-3-phosphate acyltransferase (plsY) in bacterial systems?

Glycerol-3-phosphate acyltransferase (plsY) plays a crucial role in bacterial membrane phospholipid biosynthesis, specifically in the initiation of phosphatidic acid formation, which is a precursor for membrane phospholipids . The enzyme catalyzes the transfer of an acyl group from acylphosphate to glycerol-3-phosphate . This reaction represents one of the most widely distributed biosynthetic pathways for initiating phospholipid synthesis in bacteria . In the complete pathway, acyl-acyl carrier protein is first converted to acylphosphate by PlsX, and then PlsY transfers the acyl group to glycerol-3-phosphate .

What structural features characterize the plsY enzyme?

While specific structural data on G. metallireducens plsY is limited, studies on homologous plsY proteins, such as that from Streptococcus pneumoniae, have revealed important structural features that are likely conserved. PlsY is an integral membrane protein with five membrane-spanning segments . The protein has its amino terminus and two short loops located on the external face of the membrane, while three larger cytoplasmic domains contain highly conserved sequence motifs critical for catalysis . These three conserved domains (motifs 1, 2, and 3) each play specific roles in the enzyme's function.

How do the conserved motifs in plsY contribute to its catalytic activity?

Research has identified three conserved motifs in plsY that are essential for its catalytic function:

  • Motif 1: Contains essential serine and arginine residues that are critical for catalysis .

  • Motif 2: Displays characteristics of a phosphate-binding loop and corresponds to the glycerol-3-phosphate binding site . Mutations of conserved glycines in this motif to alanines result in a defect in the Km for glycerol-3-phosphate binding .

  • Motif 3: Contains a conserved histidine and asparagine that are important for activity, as well as a glutamate that is critical to the structural integrity of plsY .

What expression systems are most suitable for producing recombinant G. metallireducens plsY?

When expressing recombinant G. metallireducens plsY, researchers must consider the membrane-bound nature of this protein. E. coli-based expression systems with specific modifications for membrane proteins are commonly employed. The pET expression system with E. coli BL21(DE3) or C43(DE3) strains (the latter specialized for membrane proteins) provides a good starting point. Expression should be conducted under anaerobic conditions to maintain native-like conditions for this anaerobic bacterium.

G. metallireducens has unique metabolic capabilities related to electron transfer and can grow autotrophically with formate and Fe(III) , suggesting that proper folding of its proteins may require specific conditions that mimic its natural environment. Consider using expression hosts with similar membrane compositions or include G. metallireducens-specific lipids during purification to maintain proper protein conformation.

What purification strategies work best for recombinant G. metallireducens plsY?

Purification of recombinant G. metallireducens plsY requires specialized approaches due to its membrane-bound nature:

  • Solubilization: Begin with gentle detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin that maintain membrane protein structure and activity.

  • Affinity Chromatography: Use N- or C-terminal affinity tags (His, Strep, or FLAG) positioned to avoid interference with the membrane-spanning regions.

  • Size-Exclusion Chromatography: For final purification and to confirm protein homogeneity.

DetergentConcentration for SolubilizationAdvantagesDisadvantages
DDM1-2%Mild, maintains activityLarger micelles
Digitonin0.5-1%Very mild, good for complexesExpensive, variable purity
LMNG0.5-1%Smaller micelles, stableSlower solubilization
SDS0.1-0.5%Highly effective solubilizationDenaturing, loss of activity

What are the optimal conditions for measuring G. metallireducens plsY activity in vitro?

For optimal in vitro activity assays of G. metallireducens plsY, researchers should consider the following conditions:

Temperature: 30°C (optimal growth temperature for G. metallireducens)
pH: 6.8-7.2 (neutral pH range for optimal activity)
Buffer: 50 mM HEPES or phosphate buffer with appropriate ionic strength

The assay should include:

  • Glycerol-3-phosphate as substrate

  • Acylphosphate or an appropriate acyl donor

  • Divalent cations (Mg²⁺ or Mn²⁺) as cofactors

  • Appropriate detergent concentration to maintain enzyme solubility without inhibiting activity

Given G. metallireducens' extremely low maintenance energy demand and ability to use alternative electron acceptors , consider testing activity under various redox conditions to determine if the enzyme shows differential activity based on cellular redox state.

How can researchers measure kinetic parameters of recombinant G. metallireducens plsY?

To measure kinetic parameters of the recombinant enzyme, researchers can employ several methodological approaches:

  • Radioisotope-based assays: Using ¹⁴C-labeled glycerol-3-phosphate or acyl donors to track product formation directly.

  • Coupled enzyme assays: Linking plsY activity to a detectable reaction, such as:

    • NADH oxidation through coupling with other enzymatic reactions

    • pH changes monitored with indicators

  • Direct product detection:

    • HPLC separation and quantification of phosphatidic acid formation

    • Mass spectrometry to identify and quantify products

For accurate kinetic parameter determination, researchers should:

  • Vary substrate concentrations across a wide range (typically 0.2-5× Km)

  • Maintain enzyme concentration in the linear response range

  • Account for potential product inhibition

  • Perform reactions under initial velocity conditions

How does the substrate specificity of G. metallireducens plsY compare with homologs from other bacteria?

While specific data on G. metallireducens plsY substrate specificity is limited, insights can be drawn from general principles and research on homologous enzymes. PlsY enzymes typically show preferences for certain acyl chain lengths in their acyl donors. G. metallireducens, as an environmental bacterium adapted to various conditions, may display broader substrate specificity than clinical isolates.

The genomic evidence suggests that metabolism in G. metallireducens may be dramatically different from other Geobacteraceae , which could extend to differences in substrate specificity of its plsY enzyme. G. metallireducens possesses greater metabolic versatility compared to G. sulfurreducens , suggesting its enzymes might accommodate a wider range of substrates.

Experimental approaches to determine substrate specificity would include:

  • Testing various acyl chain lengths (C8-C18)

  • Examining preferences for saturated versus unsaturated acyl chains

  • Investigating potential utilization of branched-chain fatty acids

How can site-directed mutagenesis help elucidate the catalytic mechanism of G. metallireducens plsY?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in G. metallireducens plsY. Based on studies of homologous proteins, targeted mutations can reveal crucial insights about catalytic mechanisms. Key residues to target include:

  • Conserved serine and arginine residues in Motif 1 that are essential for catalysis

  • Glycine residues in Motif 2 involved in glycerol-3-phosphate binding

  • Histidine, asparagine, and glutamate residues in Motif 3 important for activity and structural integrity

A systematic mutagenesis approach would involve:

  • Alanine scanning of conserved residues

  • Conservative substitutions (e.g., Asp for Glu) to probe charge requirements

  • Non-conservative substitutions to test steric constraints

Each mutant should be characterized for:

  • Expression levels and membrane localization

  • Substrate binding affinity (Km)

  • Catalytic efficiency (kcat/Km)

  • Thermal stability

What crystallization approaches might be successful for obtaining the structure of G. metallireducens plsY?

Crystallizing membrane proteins like plsY presents significant challenges. For G. metallireducens plsY, researchers might consider:

  • Detergent-based approaches:

    • Screening various detergents (DDM, OG, LDAO, etc.)

    • Lipidic cubic phase (LCP) crystallization

    • Bicelle crystallization

  • Protein engineering strategies:

    • Fusion with crystallization chaperones (e.g., T4 lysozyme)

    • Truncation of flexible regions

    • Antibody fragment co-crystallization to stabilize conformations

  • Alternative structural approaches:

    • Cryo-electron microscopy for structure determination

    • NMR studies of specific domains or reconstituted protein

The unique physiological characteristics of G. metallireducens might require specialized approaches. Since G. metallireducens can grow at very low rates (as low as 0.0008 h⁻¹) , its proteins may have distinctive stability properties that could influence crystallization conditions.

How does plsY activity relate to G. metallireducens' unique electron transfer capabilities?

G. metallireducens possesses remarkable capabilities for extracellular electron transfer, including direct electron transfer to minerals, electrodes, and even other microorganisms . While plsY itself is not directly involved in electron transfer, its role in membrane phospholipid biosynthesis may indirectly influence these processes.

Membrane composition affects:

  • Embedding and function of electron transfer proteins

  • Membrane fluidity and permeability

  • Cell surface properties that influence attachment to minerals or electrodes

G. metallireducens contains several porin-cytochrome gene clusters (including Gmet0825-0828, Gmet0908-0910, and Gmet0911-0913) that are essential for extracellular electron transfer . The proper function of these complexes likely depends on the membrane environment created in part through plsY activity.

The deletion of various porin-cytochrome gene clusters in G. metallireducens influences its ability to reduce Fe(III), interact with electrodes, and participate in direct interspecies electron transfer . The membrane composition, influenced by plsY activity, may affect how these electron transfer complexes assemble and function.

How might plsY function contribute to G. metallireducens' adaptation to subsurface environments?

G. metallireducens demonstrates remarkable adaptations to subsurface environments, including extremely low maintenance energy demand . These adaptations may involve specialized membrane compositions that function optimally under low-energy conditions.

PlsY may contribute to these adaptations through:

  • Energy-efficient membrane synthesis: G. metallireducens has among the lowest maintenance energy demands reported for heterotrophic bacteria , suggesting highly efficient membrane biosynthetic pathways.

  • Adaptive membrane composition: The ability to use alternative electron acceptors without requiring de novo protein synthesis suggests a membrane composition that can accommodate various respiratory complexes.

  • Stress response: Membranes play crucial roles in responding to environmental stressors. G. metallireducens dominates iron-reducing subsurface environments , implying effective membrane adaptations to these conditions.

What biotechnological applications might benefit from engineered versions of G. metallireducens plsY?

Engineered versions of G. metallireducens plsY could have applications in:

  • Bioremediation technologies: G. metallireducens is already used for bioremediation of metal-contaminated sites and biodegradation of organic pollutants . Engineered plsY variants could potentially improve membrane stability under toxic conditions.

  • Bioelectrochemical systems: G. metallireducens can transfer electrons directly to electrodes , making it valuable for microbial fuel cells and biosensors. Optimized membrane composition through plsY engineering might enhance electron transfer efficiency.

  • Synthetic biology: The mechanisms used by G. metallireducens for interaction with minerals, contaminants, other microbes, and electrodes have led to new technologies for bioenergy conversion and sustainable production of "green" electronics . Engineered plsY could contribute to custom membrane compositions optimized for these applications.

  • CO₂ fixation systems: G. metallireducens can grow autotrophically with formate and Fe(III) , suggesting potential applications in carbon capture technologies where engineered membrane compositions might improve performance.

How can isotope labeling techniques be applied to study phospholipid synthesis via plsY in G. metallireducens?

Isotope labeling represents a powerful approach for tracking phospholipid synthesis and turnover in G. metallireducens:

  • Carbon isotope labeling (¹³C):

    • Use ¹³C-labeled acetate, the preferred carbon source for G. metallireducens

    • Track incorporation into phospholipid acyl chains using GC-MS or LC-MS/MS

    • Determine turnover rates and flux through the plsY pathway

  • Phosphorus isotope labeling (³²P or ³³P):

    • Label glycerol-3-phosphate to track phospholipid formation

    • Quantify incorporation rates under various growth conditions

  • Deuterium labeling:

    • Use D₂O in growth media to examine hydrogen incorporation into lipids

    • Analyze membrane remodeling during adaptation to environmental changes

Given G. metallireducens' ability to grow autotrophically with formate and Fe(III) , researchers could compare lipid synthesis patterns between heterotrophic and autotrophic growth conditions to understand how membrane composition adapts to different metabolic modes.

What approaches can reveal the integration of plsY function with G. metallireducens' complex regulatory networks?

Understanding how plsY functions within G. metallireducens' regulatory networks requires multi-omics approaches:

  • Transcriptomics:

    • RNA-seq analysis under various growth conditions to identify co-regulated genes

    • Comparison of plsY expression during growth with different electron acceptors

    • Identification of transcription factors controlling plsY expression

  • Proteomics:

    • Quantitative proteomics to determine plsY protein levels across conditions

    • Protein interaction studies to identify regulatory partners

    • Post-translational modification analysis

  • Metabolomics:

    • Lipidome analysis to correlate plsY activity with membrane composition

    • Flux analysis to determine how electron transfer affects phospholipid synthesis

G. metallireducens shows remarkable adaptability, with greater metabolic versatility than G. sulfurreducens and the ability to use alternative electron acceptors without requiring de novo protein synthesis . This suggests sophisticated regulatory networks that likely influence plsY function.

How does the membrane environment affect recombinant G. metallireducens plsY activity in heterologous systems?

When expressing recombinant G. metallireducens plsY in heterologous systems, the membrane environment significantly impacts activity:

  • Lipid composition effects:

    • Phospholipid headgroup composition

    • Acyl chain length and saturation

    • Membrane fluidity and thickness

  • Reconstitution strategies:

    • Nanodiscs with controlled lipid composition

    • Proteoliposomes with G. metallireducens-like lipid profiles

    • Lipid bilayer systems for direct activity measurements

  • Environmental factors:

    • pH and ionic strength effects on membrane-protein interactions

    • Temperature effects on membrane fluidity and enzyme activity

    • Redox conditions mimicking G. metallireducens' natural environment

The unique capabilities of G. metallireducens for extracellular electron transfer suggest its membrane proteins may have adapted to specialized membrane environments. For optimal activity, recombinant expression systems should attempt to recreate these conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.