Recombinant Geobacter metallireducens Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mscL; Gmet_2522; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)
Target Names
mscL
Target Protein Sequence
MGMMEEFKEFAVKGNVVDLAVGVIIGGAFGKIVTSFVSDIVMPPLGLIMGKVNFTDLFIN LSGKPFDSLKAAKDAGAPVISYGVFINTLIDFIIIAFVIFMVIKQINRFKKEPAPAPPNT KECPHCLSAVPIKATKCAFCTSDIK
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Geobacter metallireducens and why is its mscL significant for research?

Geobacter metallireducens is a strict anaerobe first characterized by Lovley et al. in 1993 as a microorganism capable of coupling the complete oxidation of organic compounds to the reduction of iron and other metals . It belongs to the delta proteobacteria class, with Desulfuromonas acetoxidans as its closest known relative .

The large-conductance mechanosensitive channel (mscL) in bacteria functions as a pressure release valve, protecting cells from osmotic shock by opening to release intracellular solutes when membrane tension increases. In G. metallireducens, this channel may play a critical role in adaptation to the anaerobic, metal-rich environments where this bacterium thrives, potentially contributing to its unique electron transfer capabilities.

How does G. metallireducens differ from other Geobacter species in terms of metabolic capabilities?

G. metallireducens demonstrates greater metabolic versatility compared to G. sulfurreducens, which is reflected in its genome . Key differences include:

FeatureG. metallireducensG. sulfurreducens
Metabolism of organic acidsMore numerous genes for metabolism of acetate, propionate, and pyruvateFewer metabolic genes
Dicarboxylic acid transporterAbsentPresent
Succinate dehydrogenase/fumarate reductaseHas acquired a second putative complexSingle complex
Biosynthetic reducing equivalentsCan derive from oxidative pentose phosphate pathwayTypically obtained from electron transfer pathways via ferredoxin oxidoreductase
Hydrogen utilizationNon-hydrogen oxidizerHydrogen utilizing exoelectrogen
Current density in MFCs (at 0.7V)Lower (110 ± 7 A/m³)Higher (ca. 160 A/m³)
H₂ production rate1.3 ± 0.1 m³ H₂/m³/day1.9 m³ H₂/m³/day

These metabolic differences suggest that the membrane properties and potentially the mechanosensitive channels of G. metallireducens may have evolved unique characteristics to support its distinctive metabolism .

What is currently known about the genomic context of mscL in G. metallireducens?

While the search results don't specifically discuss the mscL gene in G. metallireducens, genomic analysis would typically focus on identifying conserved domains characteristic of mechanosensitive channels. The completed genome sequence of G. metallireducens is notable for "the abundance of multicopy nucleotide sequences found in intergenic regions and even within genes" , which might affect the expression and regulation of membrane proteins including mscL.

Research approaches to characterize the genomic context would include:

  • Comparative genomic analysis with well-characterized mscL genes from other bacteria

  • Transcriptomic studies to identify co-expressed genes

  • Promoter analysis to understand regulation patterns

What are the optimal expression systems for producing recombinant G. metallireducens mscL?

Based on the successful genetic tools developed for Geobacter species, the following approaches are recommended:

  • Vector selection: RK2-based plasmids show superior stability in Geobacter compared to pBBR1 plasmids, maintaining for over 15 generations without antibiotic selection .

  • Promoter systems: Several options are available:

    • Native constitutive Geobacter promoters

    • VanR-dependent inducible promoters responsive to vanillate (small aromatic carboxylic acid)

    • The vanillate induction system has demonstrated successful controlled expression in G. sulfurreducens

  • Host strain considerations: While E. coli is commonly used for initial expression trials, expression in Geobacter species may provide more authentic post-translational modifications and membrane insertion.

  • Genetic editing approach: SacB/sucrose counterselection has been demonstrated for scarless genome editing in Geobacter, allowing precise modification without antibiotic cassette insertions .

How can researchers evaluate the functionality of recombinant G. metallireducens mscL?

Functional assessment of recombinant mscL can be approached through several methods:

  • Electrophysiological techniques:

    • Patch-clamp electrophysiology of reconstituted channels in liposomes

    • Planar lipid bilayer recordings to measure single-channel conductance

  • Osmotic shock survival assays:

    • Comparing survival rates of cells expressing wild-type versus mutant channels

    • Measuring solute release during hypoosmotic shock

  • Electron transfer assays:

    • Monitoring Fe(III) reduction rates in strains with modified mscL expression

    • Electrochemical measurements using cyclic voltammetry and chronoamperometry

  • Real-time analysis:

    • The high-throughput Fe(III) citrate reduction assay described for G. sulfurreducens could be adapted to study the effects of mscL expression variations

What methods are most effective for studying the structure-function relationship of G. metallireducens mscL?

To investigate structure-function relationships, researchers should consider:

  • Site-directed mutagenesis:

    • Target conserved residues identified through sequence alignment with well-characterized mscL proteins

    • Create gain-of-function and loss-of-function mutations to probe channel gating mechanisms

  • Structural biology approaches:

    • X-ray crystallography of purified recombinant protein

    • Cryo-electron microscopy to visualize the channel in different conformational states

    • NMR studies of specific domains

  • Molecular dynamics simulations:

    • Simulate channel behavior in membranes with compositions mimicking G. metallireducens

    • Model the effects of membrane tension and interactions with other membrane components

  • Functional complementation studies:

    • Express G. metallireducens mscL in E. coli mscL knockout strains

    • Assess restoration of osmotic shock survival

How might G. metallireducens nanowires interact with mscL function?

G. metallireducens can generate conductive nanowires when lacking soluble electron acceptors . These nanowires enable electron transfer far from the cell surface, breaking through the limitations that would otherwise require direct contact with solid electron acceptors or addition of electronic mediators .

Potential interactions between nanowires and mscL may include:

  • Mechanical coupling:

    • Nanowire assembly may alter membrane tension, potentially affecting mscL gating

    • The physical connection between nanowires and the membrane might create local tension domains

  • Electron transfer influence:

    • mscL activity might modulate ion gradients that affect nanowire conductivity

    • Co-regulation of nanowire and mscL expression under electron acceptor limitation

  • Membrane organization effects:

    • Both structures exist within the bacterial membrane and may share lipid microdomains

    • Changes in membrane composition that favor nanowire formation might also affect mscL function

Research has shown that electronic mediators like AQDS can inhibit nanowire production in G. metallireducens . This suggests complex regulatory mechanisms controlling extracellular structures that might also impact membrane proteins like mscL.

What role might mscL play in G. metallireducens' extracellular electron transfer (EET)?

While not directly identified in the search results, several hypotheses regarding mscL's potential role in EET can be proposed:

  • Ion homeostasis regulation:

    • mscL could help maintain cytoplasmic ion concentrations optimal for redox reactions

    • Release of metabolites through mscL might influence local extracellular environment

  • Stress response coordination:

    • Environmental conditions favoring EET (such as metal abundance) might coincide with osmotic challenges

    • mscL activation could trigger signaling cascades affecting expression of EET components

  • Membrane potential maintenance:

    • Efficient EET requires specific membrane potential ranges

    • mscL activity could help regulate membrane potential during high rates of electron transfer

How do modifications in mscL expression affect G. metallireducens performance in microbial fuel cells?

Evidence from studies of G. metallireducens in MFCs provides context for understanding how mscL might influence electrical output:

  • Biofilm-electrode interactions:

    • Nanowire-producing biofilms demonstrate increased electron transfer efficiency between biofilm and electrodes, raising maximum output voltage to 442 mV

    • mscL may influence the formation or properties of these biofilms

  • Electrochemical characteristics:

    • Nanowire biofilm electrodes show larger cyclic voltammetry curve peaks, smaller activation resistance, and stronger current response signals

    • Changes in mscL expression might affect these parameters by altering cellular response to the electrode environment

  • Long-term performance:

    • G. metallireducens shows energy recovery of 78% ± 5% in microbial electrolysis cells at 0.7V applied voltage

    • mscL might contribute to maintaining cellular homeostasis during extended MFC operation

What are common difficulties in expressing functional recombinant G. metallireducens mscL?

Researchers may encounter several challenges:

  • Protein misfolding:

    • As a membrane protein, mscL may misfold when expressed in heterologous systems

    • Solution: Optimize growth temperature (often lower temperatures like 16-25°C are better), use specialized expression strains

  • Toxicity:

    • Overexpression of mechanosensitive channels can disrupt membrane integrity

    • Solution: Use tightly regulated inducible systems like the vanillate-inducible promoter system developed for Geobacter

  • Purification challenges:

    • Membrane proteins require careful detergent selection

    • Solution: Screen multiple detergents (DDM, LDAO, etc.) for optimal extraction and stability

  • Functional verification:

    • Confirming proper folding and function can be difficult

    • Solution: Develop robust assays such as liposome swelling tests or electrophysiological measurements

How can researchers distinguish between native and recombinant mscL activity?

To differentiate between native and recombinant channel activity:

  • Genetic approaches:

    • Create knockout strains lacking native mscL

    • Introduce tagged recombinant versions with distinguishable properties

  • Electrophysiological fingerprinting:

    • Characterize conductance, gating kinetics, and pressure sensitivity

    • Identify distinctive properties of recombinant channels (perhaps through introduced mutations)

  • Biochemical detection:

    • Use epitope tags to specifically detect recombinant protein

    • Develop antibodies specific to unique regions of G. metallireducens mscL

What controls are essential when studying the effects of mscL mutation on G. metallireducens phenotypes?

Critical controls include:

  • Expression verification:

    • Western blotting to confirm expression levels

    • Membrane fraction analysis to verify proper localization

  • Complementation controls:

    • Ensuring phenotypes can be rescued by wild-type gene reintroduction

    • Testing known functional variants from other species

  • Growth condition standardization:

    • Careful control of anaerobic conditions

    • Standardization of electron donor and acceptor concentrations

  • Metal reduction activity baseline:

    • Quantitative Fe(II) measurement assays

    • Comparison with wild-type under identical conditions

How might studying G. metallireducens mscL inform our understanding of bacterial adaptation to extreme environments?

G. metallireducens thrives in anaerobic, metal-rich environments that pose unique challenges for membrane proteins. Studying its mscL could reveal:

  • Adaptations to metal stress:

    • Potential modifications to channel structure that prevent metal-induced conformational changes

    • Gating mechanisms that function optimally in metal-rich environments

  • Anaerobic adaptations:

    • Features that allow optimal channel function under low-energy conditions

    • Potential coupling to anaerobic metabolic pathways

  • Evolution of multifunctional membrane proteins:

    • How mechanosensitive channels may have evolved additional functions in specialized bacteria

    • Comparison with mscL homologs from bacteria in different ecological niches

What potential biotechnological applications might emerge from G. metallireducens mscL research?

Promising applications include:

  • Enhanced microbial fuel cells:

    • Engineered strains with optimized mscL expression might improve electron transfer efficiency

    • MFCs using G. metallireducens with engineered mscL could potentially exceed the current maximum voltage output of 442 mV observed with nanowire-forming biofilms

  • Biosensors:

    • mscL-based tension sensors for environmental monitoring

    • Detection systems for metal contaminants

  • Bioremediation tools:

    • Engineered G. metallireducens with modified mscL for improved survival in contaminated environments

    • Enhanced metal reduction capability through optimized membrane protein function

  • Synthetic biology components:

    • mscL as a controllable gateway for release of engineered products

    • Tension-sensitive switches for synthetic circuits

How could integrating mscL function with nanowire formation lead to novel biotechnological systems?

The interaction between mscL and nanowires presents unique opportunities:

  • Responsive biofilms:

    • Biofilms that can modulate their electrical conductivity in response to mechanical stimuli

    • Systems that adjust electron transfer rates based on environmental conditions

  • Enhanced MFC stability:

    • The combination of nanowires for efficient electron transfer and mscL for osmotic protection could create more robust MFC systems

    • Long-term performance might exceed the 78% ± 5% energy recovery currently observed for G. metallireducens in microbial electrolysis cells

  • Programmable interfaces:

    • Engineered bacteria with both features could create living interfaces between biological and electronic systems

    • Potential applications in bioelectronics and biocomputing

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.