Recombinant Geobacter metallireducens NADH-quinone oxidoreductase subunit A 1 (nuoA1)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Geobacter metallireducens NADH-quinone oxidoreductase subunit A 1 (NuoA1) is a protein component of the NADH:quinone oxidoreductase (Complex I) enzyme found in the bacterium Geobacter metallireducens . Complex I, a multi-subunit integral membrane enzyme, plays a crucial role in the respiratory chains of bacteria and some archaea . It catalyzes the transfer of electrons from NADH to quinone, coupled with the translocation of protons across the membrane, contributing to the generation of a proton motive force that drives ATP synthesis .

Role in Geobacter metallireducens Metabolism

In Geobacter metallireducens, the NADH-quinone oxidoreductase, including the NuoA1 subunit, participates in electron transfer processes . Specifically, changes in the G. metallireducens metagenome have shown that genes like nuoB/C/G/L, along with por, are involved in electron transfer .

G. metallireducens employs a unique aromatic metabolism where benzoate is activated to benzoyl-CoA and then reductively dearomatized to cyclohexa-1,5-diene-1-carbonyl-CoA, followed by beta-oxidation reactions to acetyl-CoA units . The BamB-I complex, involved in anaerobic aromatic metabolism, shows similarities to soluble components of NADH:quinone oxidoreductases . The expression of genes coding for enzymes in the benzoyl-CoA degradation pathway is induced during growth on benzoate .

Bacterial Complex I Phylogeny and Distribution

Complex I is widespread in bacteria, found in approximately 50% of bacterial genomes analyzed . The genes encoding complex I (nuoA to nuoN) are often colocalized in bacterial genomes, suggesting they are part of a polycistronic operon . Phylogenomic analysis has revealed five main clades of complex I enzymes, with the evolution of these enzymes largely congruent with the evolution of the bacterial groups that encode complex I . Gammaproteobacteria are an exception, encoding one of two distantly related complex I enzymes predicted to participate in different types of respiratory chains (aerobic versus anaerobic) .

Functional Diversity and Importance

Complex I plays a broad role in reoxidizing NADH produced from various catabolic reactions, including the tricarboxylic acid (TCA) cycle and fatty acid beta-oxidation . This enzyme is essential in shaping diverse physiologies across the bacterial domain .

Table of Geobacter metallireducens NADH-quinone Oxidoreductase Subunit A 1 (NuoA1)

FeatureDescription
OrganismGeobacter metallireducens
Protein NameNADH-quinone oxidoreductase subunit A 1 (NuoA1)
FunctionPart of the NADH:quinone oxidoreductase (Complex I) enzyme complex, involved in electron transfer
UniProt IDQ39ZC5
Amino Acid Length138
Molecular WeightVaries depending on expression and tag
Expression HostE. coli
TagN-terminal His tag (for purification)
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, add 5-50% glycerol for storage
SynonymsnuoA1; Gmet_0152; NADH dehydrogenase I subunit A 1; NDH-1 subunit A 1; NUO1 1

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nuoA1; Gmet_0152; NADH-quinone oxidoreductase subunit A 1; NADH dehydrogenase I subunit A 1; NDH-1 subunit A 1; NUO1 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)
Target Names
nuoA1
Target Protein Sequence
MQQTTVANHSLFPTLPPEFLPLALYTVAATVLIGVLLLAAWWLGAKTTNRNKELPYESGV IPTGSARLAYPVPFYLIAIFFIVFDVEAAFIFAWATAWRELGLAGLIHITFFIVILLLGL VWLWMKGGLDWGPSRERR
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this species, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thus conserving energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of nuoA1 in Geobacter metallireducens?

The nuoA1 gene is part of the NADH-quinone oxidoreductase complex encoded within the G. metallireducens genome, which has a chromosome length of 3,997,420 bp and a GC content of 59.51% . This complex plays a crucial role in the electron transport chain of this anaerobic bacterium. The genomic organization of nuoA1 appears within a circular bacterial chromosome structure that has no free DNA ends, resembling an egg-like shape . When conducting studies on nuoA1, researchers should consider its genomic relationship to other subunits of the NADH-quinone oxidoreductase complex and related energy metabolism genes to understand functional associations. The exact position and orientation of nuoA1 on the chromosome should be mapped prior to experimental manipulation for recombinant expression.

How does nuoA1 contribute to the electron transport mechanisms in Geobacter metallireducens?

The NADH-quinone oxidoreductase subunit A1 (nuoA1) is a critical component of Complex I in the electron transport chain of G. metallireducens. This complex catalyzes the transfer of electrons from NADH to quinones in the respiratory chain, contributing to the organism's unique ability to utilize insoluble metals as electron acceptors . The nuoA1 protein works in conjunction with other subunits to enable the bacterium's distinctive capacity to reduce Fe(III) and Mn(IV) oxides as part of its energy metabolism . This electron transport mechanism is fundamental to the bacterium's ability to function as a strict anaerobe that oxidizes short-chain fatty acids, alcohols, and monoaromatic compounds with Fe(III) as the sole electron acceptor . Understanding nuoA1's role is essential for research into bioremediation applications, particularly in environments contaminated with metals or uranium.

What are the structural features that distinguish nuoA1 from related oxidoreductase subunits?

The nuoA1 subunit of NADH-quinone oxidoreductase in G. metallireducens shares functional similarity with NAD(P)H:quinone oxidoreductases found in other organisms, but exhibits specific structural adaptations that enable its function in metal reduction. Similar to the human NQO1 (a FAD-dependent flavoprotein), the nuoA1 protein likely facilitates electron transfers, but has evolved distinct features for interaction with metal ions rather than the quinones, quinoneimines, and other substrates processed by human NQO1 .

The key structural features include:

Structural ElementFunctionComparison to Human NQO1
Metal-binding domainsFacilitate interaction with Fe(III) and other metalsNot present in human NQO1
Redox-active centersEnable electron transfer to insoluble metalsSimilar but adapted for different electron acceptors
Membrane association regionsPosition the protein for optimal electron transportDifferent membrane association patterns
FAD binding siteEnables initial electron acceptance from NADHPresent in both but with different binding geometries

These structural adaptations reflect G. metallireducens' specialization for metal reduction in anaerobic environments, distinguishing nuoA1 from related oxidoreductases in other organisms.

What are the optimal expression systems for producing recombinant nuoA1 protein?

When designing expression systems for recombinant nuoA1 from G. metallireducens, researchers should consider the following methodological approaches:

  • Host Selection: E. coli BL21(DE3) strains with rare codon supplementation are recommended, as G. metallireducens has a high GC content (59.51%) , which may lead to codon usage bias. Alternative hosts like Pseudomonas species may provide better compatibility with the GC-rich gene.

  • Vector Design: Incorporate a cleavable N-terminal His-tag for purification, with a TEV protease recognition site. Include the RelE/ParE stabilizing protein elements, similar to those found in G. metallireducens plasmids , to enhance protein stability.

  • Expression Conditions: Maintain anaerobic conditions during induction and expression, as nuoA1 functions in an anaerobic environment naturally. Use a defined medium supplemented with iron to facilitate proper folding of any metal-binding domains.

  • Purification Protocol:

StepBuffer CompositionConditionsPurpose
Cell Lysis50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, 1 mM DTTAnaerobic chamberPreserve protein integrity
IMACAbove + 10-300 mM imidazole gradient4°C, anaerobicInitial purification
TEV Cleavage50 mM Tris-HCl pH 7.5, 100 mM NaCl, 1 mM DTT16h, 4°CTag removal
Size Exclusion20 mM HEPES pH 7.0, 150 mM NaCl, 5% glycerolAnaerobicFinal purification
  • Activity Verification: Adapt the resazurin reduction assay used for human NQO1 , substituting Fe(III) compounds as electron acceptors to confirm the functionality of the recombinant protein.

This expression system design accounts for the unique properties of G. metallireducens proteins while providing a methodological framework for obtaining pure, active nuoA1.

How can researchers effectively measure nuoA1 activity in experimental settings?

Measuring nuoA1 activity requires specialized approaches that account for its role in electron transport and metal reduction. A comprehensive activity assay protocol should include:

  • Electron Donor Preparation: Prepare NADH solution at 400 μM in anaerobic assay buffer (similar to the 200 μM used for human NQO1) , as NADH serves as the electron donor.

  • Electron Acceptor Options:

    • Fe(III) citrate (soluble form)

    • Fe(III) oxide (insoluble form)

    • Resazurin (as a colorimetric/fluorometric alternative)

  • Basic Activity Assay Procedure:

    • Combine 50 μL of purified recombinant nuoA1 (0.0075-0.375 μg/mL range) with 50 μL of substrate mixture containing both NADH and the electron acceptor

    • Monitor activity through:

      • Fe(III) reduction to Fe(II) using ferrozine assay

      • Resazurin reduction to resorufin (fluorescence at excitation/emission 540/585 nm)

  • Specific Activity Calculation:

Specific Activity (pmol/min/μg)=Adjusted Vmax (RFU/min)×Conversion Factor (pmol/RFU)amount of enzyme (μg)\text{Specific Activity (pmol/min/μg)} = \frac{\text{Adjusted V}_{\text{max}} \text{ (RFU/min)} \times \text{Conversion Factor (pmol/RFU)}}{\text{amount of enzyme (μg)}}

  • Controls and Validation:

    • Include substrate blanks with buffer instead of enzyme

    • Perform assays at varying pH values (6.0-8.0) to determine optimum

    • Include metal chelators in control reactions to confirm metal-dependent activity

This methodological approach provides quantitative assessment of nuoA1 activity while accounting for its unique electron transport capabilities in G. metallireducens.

What N-of-1 experimental designs are suitable for investigating nuoA1 variants?

N-of-1 experimental designs can be valuable for investigating nuoA1 variants, particularly when exploring site-directed mutagenesis effects or natural variant comparisons. These approaches are especially useful when material constraints or technical challenges limit traditional larger-scale studies .

For nuoA1 variants, consider these N-of-1 experimental design strategies:

  • Multiple Crossover Design: Test individual nuoA1 variants sequentially with washout periods between tests . This approach allows direct comparison of variant performance using the same experimental setup, reducing system variability.

  • ABA Withdrawal Design: Measure baseline activity, introduce the variant nuoA1, then return to baseline conditions . This is particularly useful for assessing how mutations affect electron transfer rates or metal reduction capabilities.

  • Parameter Table for N-of-1 nuoA1 Variant Studies:

Design ElementImplementationAnalytical Consideration
Treatment Periods3-5 days per variantAllows protein stability assessment
Washout Periods1-2 days between variantsPrevents carryover effects
Outcome MeasuresMultiple (activity, binding affinity, stability)Provides comprehensive variant characterization
RandomizationLatin square design for variant sequenceMinimizes order effects
BlindingSingle-blind for activity measurementsReduces measurement bias
  • Data Analysis Approach: Apply time-series analysis methods that account for autocorrelation, potentially using Bayesian statistics to incorporate prior knowledge about nuoA1 structure-function relationships .

This methodological framework enables rigorous investigation of nuoA1 variants even with limited resources, providing statistically robust insights into structure-function relationships within this important oxidoreductase subunit.

How should researchers approach contradictory findings in nuoA1 expression studies?

When encountering contradictory data in nuoA1 expression studies, researchers should implement a systematic approach that embraces these contradictions as valuable insights rather than problems to eliminate . This methodological framework includes:

  • Data Triangulation Protocol:

    • Document all contradictory findings without premature dismissal

    • Analyze experimental conditions systematically to identify variables that might explain differences

    • Consider that contradictions may reflect genuine biological complexity of nuoA1 regulation

  • Contextual Variables Assessment:

    • Examine differences in G. metallireducens growth conditions across studies

    • Consider anaerobic vs. microaerobic conditions, which may affect nuoA1 expression

    • Assess metal availability variations between experiments

  • Interpretive Framework for Contradictions:

Contradiction TypePotential ExplanationInvestigation Approach
Expression level discrepanciesHeterologous host differencesComparative expression in multiple systems
Activity differencesPost-translational modificationsProteomic analysis of purified protein
Localization variationsMembrane association factorsSubcellular fractionation studies
Electron acceptance preferencesExperimental redox conditionsSystematic redox potential testing
  • Integration Strategy: As noted in "The Rise of the Insight Alchemist," adopt a data-agnostic mindset that acknowledges all data as imperfect and values contradictions as opportunities rather than problems . Specifically for nuoA1 research, this means integrating expression data from different conditions to build a comprehensive model of regulation.

Remember that contradictions in nuoA1 data likely reflect its complex role in G. metallireducens' adaptability to different metal-reducing environments . By methodically investigating these contradictions rather than dismissing them, researchers can gain deeper insights into the functional versatility of this important oxidoreductase subunit.

What bioinformatic approaches best identify functional domains in nuoA1?

Identifying functional domains in nuoA1 requires specialized bioinformatic methods that account for the unique characteristics of G. metallireducens as a metal-reducing bacterium. The following methodological approach is recommended:

  • Primary Sequence Analysis Pipeline:

    • Begin with homology-based approaches comparing nuoA1 to characterized NADH-quinone oxidoreductase subunits

    • Apply specialized transmembrane prediction algorithms (TMHMM, HMMTOP) to identify membrane-spanning regions

    • Use metal-binding site prediction tools (MetalDetector, MIB) to identify potential interaction sites with Fe(III) and other metals

  • Comparative Genomics Framework:

    • Analyze nuoA1 sequences across Geobacter species to identify conserved residues

    • Compare with nuoA subunits from non-metal reducing bacteria to highlight specializations

    • Construct phylogenetic trees to visualize evolutionary relationships

  • Structural Biology Integration:

    • Generate homology models using templates from related oxidoreductases

    • Apply molecular dynamics simulations to predict conformational changes during electron transfer

    • Identify potential electron transfer pathways using specialized algorithms

  • Domain Classification Matrix:

Domain TypePrediction MethodValidation Approach
TransmembraneTMHMM, HMMTOPMembrane fractionation
Metal-bindingMetalDetector, conservation analysisSite-directed mutagenesis
NADH interactionHomology modeling, docking simulationsActivity assays with NADH analogs
Quinone bindingMolecular dynamics, dockingCompetition assays
Protein-protein interactionConservation surface mappingCrosslinking studies
  • Functional Validation Design: For each predicted domain, design experimental validation approaches including site-directed mutagenesis followed by activity assays using the methods described in section 3.2.

This comprehensive bioinformatic approach enables the systematic identification and characterization of functional domains in nuoA1, providing a foundation for understanding its role in G. metallireducens' metal reduction capabilities.

How can researchers utilize Google's "People Also Ask" data to identify knowledge gaps in nuoA1 research?

Google's "People Also Ask" (PAA) feature can serve as a valuable tool for identifying knowledge gaps and research priorities in nuoA1 research. This data-driven approach reveals common questions that may highlight understudied aspects of nuoA1 function . A methodological framework for utilizing this resource includes:

  • Systematic Query Construction:

    • Develop a hierarchical set of search terms centered on "Geobacter metallireducens nuoA1"

    • Include broader terms (NADH-quinone oxidoreductase, electron transport chain)

    • Include specific function-related terms (metal reduction, electron transport)

  • PAA Data Collection Protocol:

    • Record all PAA questions for each search term

    • Note the cascading questions that appear after clicking initial PAAs

    • Track question frequency across multiple searches to identify recurring themes

  • Analytical Framework for Identifying Knowledge Gaps:

PAA Data PatternInterpretationResearch Opportunity
Recurring methodology questionsTechnical challenges existDevelop improved protocols
Questions about interactionsPotential unknown protein partnersInteractome studies
Comparison questions with other bacteriaEvolutionary importanceComparative genomics
Function under specific conditionsEnvironmental adaptabilityCondition-specific expression studies
  • Strategic Research Planning:

    • Prioritize research questions that appear frequently in PAAs but have limited published answers

    • Use PAA data to inform grant applications by highlighting recognized knowledge gaps

    • Track changes in PAAs over time to identify emerging research directions

This methodological approach transforms Google's PAA feature from a simple search tool into a strategic research planning instrument. By appearing in over 80% of English searches , PAAs provide a window into the scientific community's questions about nuoA1, helping researchers align their work with existing knowledge gaps and potentially increasing both the impact and fundability of their research.

What methodological approaches best determine the role of nuoA1 in uranium bioremediation?

Investigating nuoA1's role in uranium bioremediation requires specialized methodological approaches that integrate molecular biology, biogeochemistry, and environmental science. The following research framework is recommended:

  • Gene Knockout and Complementation System:

    • Generate nuoA1 deletion mutants in G. metallireducens

    • Create complementation strains with wild-type nuoA1

    • Develop point mutants targeting predicted functional domains

    • Assess each strain's uranium reduction capability in controlled settings

  • Uranium Reduction Assay Protocol:

    • Expose wild-type and mutant G. metallireducens strains to U(VI) under anaerobic conditions

    • Monitor U(IV) formation using colorimetric assays and X-ray absorption spectroscopy

    • Quantify reduction rates and compare between strains

    • Correlate with expression levels of nuoA1 determined by RT-qPCR

  • Electron Transfer Mechanism Investigation:

    • Employ cyclic voltammetry to measure electron transfer kinetics

    • Use protein film voltammetry with purified nuoA1 to assess direct electron transfer to uranium

    • Apply spectroelectrochemical techniques to monitor redox changes during uranium reduction

  • Environmental Relevance Assessment:

ParameterMeasurement ApproachRelevance to Bioremediation
pH influenceU(VI) reduction at pH 5-8Applicability across contaminated sites
Competing metalsReduction rates with Fe(III), Mn(IV) presentPerformance in mixed-metal environments
Oxygen sensitivityActivity retention after oxygen exposureRobustness at oxic-anoxic interfaces
Temperature rangeReduction rates at 10-37°CSeasonal applicability
Biofilm formationConfocal microscopy of U(IV) depositsIn situ immobilization potential
  • Field-Scale Implementation Design:

    • Develop biosensors based on nuoA1 expression to monitor uranium reduction activity

    • Create engineered G. metallireducens strains with enhanced nuoA1 expression

    • Design bioaugmentation strategies for contaminated sites

This comprehensive methodological framework enables researchers to thoroughly characterize nuoA1's role in uranium bioremediation by G. metallireducens, leveraging the organism's known ability to use uranium for growth and convert U(VI) to U(IV) .

How does nuoA1 expression correlate with metal reduction capabilities across different Geobacter species?

Investigating correlations between nuoA1 expression and metal reduction capabilities across Geobacter species requires a methodologically rigorous comparative approach. This research question addresses both evolutionary adaptations and potential biotechnological applications, requiring the following framework:

  • Comparative Genomics Protocol:

    • Identify nuoA1 homologs across sequenced Geobacter species

    • Analyze promoter regions and regulatory elements

    • Construct phylogenetic trees to visualize evolutionary relationships

    • Correlate sequence variations with known metal reduction preferences

  • Standardized Expression Analysis:

    • Develop species-neutral RT-qPCR primers targeting conserved nuoA1 regions

    • Establish normalized expression protocols across species

    • Measure baseline expression and response to different metal electron acceptors

    • Apply RNA-seq to identify co-expressed genes across species

  • Metal Reduction Profiling:

    • Test each species with standardized panel of metals: Fe(III), Mn(IV), U(VI), Cr(VI), others

    • Measure reduction rates using standardized assays

    • Determine electron transfer efficiencies for each metal-species combination

    • Correlate with nuoA1 expression levels and sequence variations

  • Comparative Data Matrix:

SpeciesnuoA1 Sequence Similarity to G. metallireducensExpression Level (Relative to housekeeping genes)Fe(III) Reduction Rate (μmol/hr)U(VI) Reduction Rate (μmol/hr)Other Metals
G. metallireducens100%1.00[measured][measured][measured]
G. sulfurreducens[calculated][measured][measured][measured][measured]
[Other species][calculated][measured][measured][measured][measured]
  • Structure-Function Analysis:

    • Express recombinant nuoA1 variants from different species

    • Compare biochemical properties and metal affinities

    • Perform domain swapping experiments between species

    • Create chimeric nuoA1 proteins to identify metal specificity determinants

This methodological approach provides a comprehensive framework for understanding how nuoA1 variants contribute to the diverse metal reduction capabilities observed across Geobacter species, potentially revealing evolutionary adaptations to different metal-rich environments and identifying variants with enhanced bioremediation potential.

What are common pitfalls in nuoA1 purification and how can they be addressed?

Purifying recombinant nuoA1 presents several technical challenges due to its membrane association, metal interactions, and oxygen sensitivity. The following methodological troubleshooting guide addresses common pitfalls:

  • Low Expression Yields:

ProblemPotential CauseSolution
Minimal protein detectionToxicity to host cellsUse tightly controlled induction systems; consider cell-free expression
Inclusion body formationImproper foldingLower induction temperature (16-18°C); co-express chaperones
Rapid degradationProtein instabilityInclude protease inhibitors; express with stabilizing fusion partners
Poor translationCodon bias from high GC content (59.51%) Use codon-optimized constructs or specialized expression strains
  • Oxygen Sensitivity Protocol:

    • Maintain strictly anaerobic conditions throughout purification

    • Add reducing agents (DTT, β-mercaptoethanol) to all buffers

    • Consider purification in anaerobic chamber

    • Validate protein activity immediately after purification

  • Metal Interaction Management:

    • Include appropriate metal chelators to prevent non-specific binding

    • For functional studies, selectively reintroduce specific metals

    • Use metal-affinity chromatography strategically, with controlled elution gradients

    • Monitor metal content using ICP-MS throughout purification

  • Membrane Association Challenges:

    • Test different detergents systematically (DDM, LDAO, Triton X-100)

    • Optimize detergent:protein ratios to prevent aggregation

    • Consider amphipol substitution for long-term stability

    • Validate proper folding using circular dichroism after detergent extraction

  • Activity Loss During Purification:

    • Minimize purification steps and handling time

    • Include stabilizing agents (glycerol, specific lipids)

    • Develop activity assays for each purification stage

    • Consider leaving fusion tags intact if they don't interfere with activity

This comprehensive troubleshooting framework addresses the specific challenges of nuoA1 purification from G. metallireducens, enabling researchers to obtain functionally active protein for detailed biochemical and structural studies.

How can researchers optimize electron donor/acceptor ratios for maximal nuoA1 activity measurement?

Optimizing electron donor/acceptor ratios is critical for accurate nuoA1 activity measurements, particularly given the complex redox biochemistry of this G. metallireducens protein. The following methodological approach enables systematic optimization:

  • Electron Donor Optimization:

    • Test NADH concentration range (50-500 μM, extending from the 200 μM baseline used for human NQO1)

    • Evaluate alternative donors (NADPH, artificial electron donors)

    • Determine donor stability under experimental conditions

    • Establish minimum donor concentration for maximal activity

  • Electron Acceptor Titration:

    • For each acceptor type (Fe(III) compounds, alternative metals, artificial acceptors), perform systematic concentration titrations

    • Determine kinetic parameters (Km, Vmax) for each acceptor

    • Identify potential inhibitory concentrations

    • Establish optimal acceptor:enzyme ratios

  • Ratio Optimization Matrix:

Electron DonorElectron AcceptorOptimal RatioSpecific Activity (pmol/min/μg)Notes
NADHFe(III) citrate[determined][measured]Soluble acceptor
NADHFe(III) oxide[determined][measured]Insoluble acceptor
NADHResazurin[determined][measured]Colorimetric detection
NADHU(VI) compounds[determined][measured]Bioremediation relevance
NADPH[various acceptors][determined][measured]Alternative donor
  • Environmental Parameter Optimization:

    • Test pH range (5.0-8.5) for each donor/acceptor pair

    • Evaluate temperature effects (15-40°C)

    • Assess buffer composition impacts

    • Determine optimal ionic strength

  • Measurement Protocol Refinement:

    • For spectrophotometric assays, determine optimal wavelengths for each donor/acceptor pair

    • Establish linear range of detection

    • Develop standard curves for absolute quantification

    • Optimize reading intervals for reaction rate calculations based on the specific activity calculation method used for human NQO1

This systematic optimization framework ensures accurate and reproducible measurements of nuoA1 activity, accounting for the unique redox properties of this protein and its natural role in G. metallireducens' metal reduction pathways.

What are the most promising future research directions for nuoA1 in bioremediation applications?

Based on current understanding of G. metallireducens nuoA1 and its role in metal reduction, several high-potential research directions emerge for bioremediation applications. These directions combine fundamental knowledge of nuoA1 function with practical bioremediation needs:

  • Engineered nuoA1 Variants for Enhanced Metal Specificity: Developing variants with increased affinity for specific contaminants could dramatically improve bioremediation efficiency for targeted pollutants. Structure-guided mutagenesis of nuoA1, informed by the metal-binding domain analysis discussed in section 4.2, offers a path to tailored bioremediation solutions for different contaminated sites.

  • nuoA1-Based Biosensors for Contaminant Monitoring: The metal-reducing properties of nuoA1 could be leveraged to develop whole-cell or protein-based biosensors that provide real-time feedback on bioremediation progress. These sensors could combine nuoA1 with reporter systems to visualize metal reduction activity in the field.

  • Co-expression Systems with Complementary Enzymes: Designing systems that co-express nuoA1 with other enzymes involved in contaminant degradation could create more robust bioremediation platforms. For instance, combining nuoA1 with enzymes that degrade organic pollutants could address mixed contamination scenarios.

  • Immobilization Technologies for Field Deployment: Developing methods to immobilize nuoA1-expressing cells or purified protein on suitable matrices could enhance field application. This direction builds on G. metallireducens' natural ability to form biofilms and interact with solid surfaces during metal reduction .

  • Microbial Fuel Cell Integration: Exploring nuoA1's potential in microbial fuel cells could create systems that simultaneously remediate contaminated sites and generate electricity. This direction leverages the electron transfer capabilities central to nuoA1 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.