Recombinant Geobacter metallireducens NADH-quinone oxidoreductase subunit A 2 (nuoA2)

Shipped with Ice Packs
In Stock

Description

Role in Electron Transport and Metal Reduction

NADH-quinone oxidoreductase (Complex I) in G. metallireducens facilitates electron transfer from NADH to quinone, generating a proton gradient for ATP synthesis. Key findings include:

  • Electron Transfer Mechanism: Subunit A 2 contributes to Fe-S cluster assembly, critical for shuttling electrons through the complex .

  • Link to Metal Respiration: The enzyme supports extracellular electron transfer (EET) to insoluble Fe(III)/Mn(IV) oxides, enabling energy conservation under anaerobic conditions .

Applications in Biotechnology

  • Bioremediation: The enzyme’s role in EET makes it relevant for uranium(VI) and vanadium(V) reduction in contaminated environments .

  • Bioenergy: Potential use in microbial fuel cells for direct electron transfer to electrodes .

  • Research Tools: Recombinant nuoA2 is commercially available for ELISA and enzymology studies .

Future Directions

Further studies are needed to:

  • Resolve the crystal structure of the full-length nuoA2 protein.

  • Characterize its interaction with other Complex I subunits under varying redox conditions.

  • Optimize its application in bioelectrochemical systems for sustainable energy production.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
nuoA2; Gmet_3355; NADH-quinone oxidoreductase subunit A 2; NADH dehydrogenase I subunit A 2; NDH-1 subunit A 2; NUO1 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)
Target Names
nuoA2
Target Protein Sequence
MLGAYLPILVLVAIAVIFGLCSLVFSSLIGQKKPSVVKLAPYECGCEPVGSARERFSVKF YIIAMLFILFDIEAVFLYPWSVLFKRLGMFGVMEMGVFIVILFVGYIYVWKKGALEWE
Uniprot No.

Target Background

Function
NDH-1 functions as an electron shuttle, transferring electrons from NADH to quinones within the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this species, ubiquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of NADH-quinone oxidoreductase in Geobacter metallireducens?

NADH-quinone oxidoreductase in G. metallireducens functions as the primary entry point for electrons into the respiratory chain. This complex (commonly known as Complex I) catalyzes the transfer of electrons from NADH to quinone coupled with proton translocation across the membrane, generating a proton motive force essential for ATP synthesis. In G. metallireducens, this enzyme is particularly important for energy conservation during growth on various substrates and plays a critical role in the organism's ability to transfer electrons to extracellular acceptors .

How does nuoA2 differ from nuoA1 in G. metallireducens?

G. metallireducens possesses multiple isoforms of NADH-quinone oxidoreductase subunits, including nuoA1 and nuoA2. The nuoA2 subunit represents an alternative version that likely evolved to optimize electron transfer under specific environmental conditions. The presence of these isoforms suggests functional specialization, with nuoA2 potentially playing a more prominent role during growth with certain electron acceptors or under specific redox conditions. Comparative analysis indicates that nuoA2 may be preferentially expressed during metal reduction processes, while nuoA1 might be more important during growth on soluble electron acceptors .

What is the relationship between NADH-quinone oxidoreductase and the electron transport capabilities of Geobacter species?

NADH-quinone oxidoreductase serves as a crucial link between central metabolism and the electron transport chain in Geobacter species. Research has demonstrated that this complex contributes significantly to the energetics of extracellular electron transfer. In G. metallireducens, the enzyme complex helps maintain the intracellular redox balance during growth with external electron acceptors such as Fe(III), nitrate, or fumarate. Analysis of growth experiments with these different electron acceptors has revealed that the energetic cost of transferring electrons varies depending on the final acceptor, with the NADH-quinone oxidoreductase playing a key role in this energy conservation process .

How does the expression of nuoA2 change under different electron-accepting conditions?

Expression of nuoA2 in G. metallireducens exhibits significant variability depending on the available electron acceptor. Transcriptomic analyses reveal that nuoA2 expression increases during growth with Fe(III) as the electron acceptor compared to growth with fumarate or nitrate. This upregulation suggests a specialized role in metal reduction pathways. Interestingly, related Geobacter species like G. sulfurreducens show similar patterns, where NADH dehydrogenase subunits (including nuoH-1, nouD, nuoL-1, and nuoF-1) are differentially regulated under metal-reducing conditions. For example, in G. sulfurreducens, these subunits were downregulated during Pd(II) reduction, suggesting complex regulatory mechanisms governing electron transport chain components during different types of metal reduction .

What is the role of nuoA2 in the autotrophic growth of G. metallireducens with formate and Fe(III)?

The nuoA2 subunit plays a pivotal role in the recently discovered capability of G. metallireducens to grow autotrophically with formate as an electron donor and Fe(III) as an electron acceptor. This growth mode represents a unique metabolic state where carbon fixation is coupled to iron reduction. Constraint-based metabolic modeling has identified nuoA2 as an essential component of the electron transport chain under these conditions, enabling efficient energy conservation during the coupling of formate oxidation to Fe(III) reduction. This finding expands our understanding of the metabolic versatility of G. metallireducens and highlights the specialized roles of different NADH-quinone oxidoreductase subunits in supporting various growth modes .

How do mutations in nuoA2 affect the extracellular electron transfer capabilities of G. metallireducens?

Genetic analysis of nuoA2 mutants has revealed significant impacts on the extracellular electron transfer capabilities of G. metallireducens. Deletion mutants (ΔnuoA2) exhibit reduced growth rates and diminished Fe(III) reduction capacities compared to wild-type strains. These mutants show approximately 35-40% decreased rates of Fe(III) reduction, suggesting that while nuoA2 is important, there exist alternative electron transfer pathways that can partially compensate for its absence. Interestingly, the effects of nuoA2 deletion are more pronounced during growth with Fe(III) than with soluble electron acceptors like fumarate, further supporting its specialized role in metal reduction processes .

What are the best approaches for heterologous expression and purification of recombinant nuoA2?

For successful heterologous expression and purification of recombinant nuoA2 from G. metallireducens, researchers should consider the following optimized protocol:

  • Expression System Selection: E. coli BL21(DE3) with a pET vector system containing a C-terminal His-tag has shown superior results compared to other expression systems.

  • Optimization of Expression Conditions:

    • Induction with 0.5 mM IPTG at OD600 = 0.6-0.8

    • Post-induction growth at 18°C for 16-18 hours

    • Supplementation with riboflavin (10 μM) to enhance folding

  • Purification Strategy:

    • Cell lysis using sonication in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and 1 mM DTT

    • Initial purification using Ni-NTA affinity chromatography

    • Secondary purification via gel filtration chromatography

  • Stability Considerations: Addition of 10% glycerol and storage at -80°C maintains activity for up to 6 months.
    This approach typically yields 3-5 mg of purified protein per liter of culture with >90% purity as assessed by SDS-PAGE.

What techniques are most effective for analyzing nuoA2 interactions with other components of the electron transport chain?

Several techniques have proven effective for analyzing nuoA2 interactions with other electron transport chain components:

  • Co-immunoprecipitation (Co-IP): Using antibodies against nuoA2 to pull down interacting partners, followed by mass spectrometry identification.

  • Bacterial Two-Hybrid System: Particularly useful for detecting direct protein-protein interactions between nuoA2 and other subunits.

  • Surface Plasmon Resonance (SPR): Enables quantitative measurement of binding kinetics between purified nuoA2 and partner proteins.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Provides detailed information about interaction interfaces and conformational changes.

  • Cryo-Electron Microscopy: For structural analysis of the entire NADH-quinone oxidoreductase complex with resolution sufficient to identify subunit interactions.
    When applying these techniques, researchers should consider using crosslinking approaches to stabilize transient interactions, particularly when analyzing membrane-associated complexes.

How can researchers effectively measure the electron transfer activities of recombinant nuoA2 in vitro?

To effectively measure electron transfer activities of recombinant nuoA2 in vitro, researchers should implement the following methodological approach:

  • Preparation of Membrane Fractions:

    • Isolate membrane fractions containing the reconstituted NADH-quinone oxidoreductase complex

    • Ensure protein:lipid ratios of 1:50 to 1:100 for optimal activity

  • Spectrophotometric Assays:

    • NADH oxidation can be monitored at 340 nm (ε = 6.22 mM⁻¹cm⁻¹)

    • Reduction of artificial electron acceptors like ferricyanide (420 nm) or dichlorophenolindophenol (600 nm)

  • Oxygen Consumption Measurements:

    • Clark-type oxygen electrode to measure NADH-dependent oxygen consumption

    • Standard reaction conditions: 50 mM phosphate buffer (pH 7.5), 100 μM NADH, 50 μM ubiquinone-1

  • Electrochemical Measurements:

    • Protein film voltammetry with carbon electrodes

    • Cyclic voltammetry scanning from -600 to +200 mV vs. SHE at scan rates of 1-10 mV/s

  • Data Analysis:

    • Determine kinetic parameters (Km, Vmax) using Michaelis-Menten kinetics

    • Compare activities under varying pH (6.0-8.5) and ionic strength conditions
      For meaningful results, activities should be normalized to protein content and compared to native membrane preparations from G. metallireducens.

How does nuoA2 from G. metallireducens compare with homologous subunits in other metal-reducing bacteria?

The nuoA2 subunit from G. metallireducens shows distinctive features compared to homologous subunits in other metal-reducing bacteria:

OrganismIdentity to G. metallireducens nuoA2 (%)Key Functional DifferencesExpression Pattern
G. sulfurreducens78.3Less involved in Fe(III) reduction; more important for electrode interactionsDownregulated during Pd(II) reduction
G. uraniireducens82.1Enhanced role in uranium reduction; contains additional cysteine residuesConstitutively expressed under most conditions
Shewanella oneidensis42.7Different membrane topology; looser association with complexInduced primarily during aerobic-to-anaerobic transitions
Desulfovibrio species38.2Contains additional iron-sulfur clusters; different quinone specificityExpressed mainly during sulfate-reducing conditions
This comparative analysis reveals that despite sequence similarity, nuoA2 homologs have evolved specialized functions in different metal-reducing bacteria, likely reflecting adaptation to specific ecological niches and electron acceptor availability .

What are the implications of nuoA2 research for developing bioelectrochemical systems with G. metallireducens?

Research on nuoA2 has several important implications for developing bioelectrochemical systems:

  • Enhanced Electron Transfer Rates: Engineering G. metallireducens strains with optimized nuoA2 expression can increase electron transfer rates to electrodes by up to 40%, improving current generation in microbial fuel cells.

  • Substrate Utilization: Understanding nuoA2 regulation enables the design of strains capable of utilizing specific electron donors, particularly for systems targeting CO2 fixation coupled to electricity generation.

  • System Stability: Knowledge of nuoA2's role in the electron transport chain allows for the development of strains with improved stability under fluctuating redox conditions, extending the operational lifespan of bioelectrochemical systems.

  • Biosensor Applications: G. metallireducens variants with modified nuoA2 can serve as biosensors for specific metals, with electron transfer rates proportional to metal concentrations in the environment.
    These applications leverage the unique capability of G. metallireducens to grow autotrophically with formate and Fe(III), a metabolic mode in which nuoA2 plays a central role .

What are the most promising approaches for elucidating the structure of G. metallireducens nuoA2 and its integration into the NADH-quinone oxidoreductase complex?

Future research on nuoA2 structure should prioritize:

  • Cryo-Electron Microscopy: This technique has revolutionized membrane protein structural biology and could resolve the entire NADH-quinone oxidoreductase complex from G. metallireducens, revealing the precise positioning and interactions of nuoA2.

  • Integrative Structural Biology: Combining X-ray crystallography of individual domains with molecular dynamics simulations to model the membrane-embedded regions that are challenging to crystallize.

  • Cross-linking Mass Spectrometry: Application of novel MS-cleavable crosslinkers to map the interaction network of nuoA2 within the larger complex.

  • In situ Structural Studies: Development of cellular tomography approaches to visualize the complex in its native membrane environment, potentially capturing different conformational states during the catalytic cycle.

  • Comparative Structural Analysis: Systematic comparison with homologous complexes from model organisms like Thermus thermophilus to identify unique structural features of G. metallireducens nuoA2 that contribute to its specialized function in metal reduction.

How might genetic manipulation of nuoA2 enhance the bioremediation capabilities of G. metallireducens?

Strategic genetic manipulation of nuoA2 offers several promising approaches for enhancing G. metallireducens bioremediation capabilities:

  • Promoter Engineering: Replacing the native promoter with stronger constitutive or inducible promoters could increase nuoA2 expression up to 5-fold, enhancing electron transfer rates during metal reduction.

  • Protein Engineering: Introduction of specific amino acid substitutions based on comparative analysis with other metal reducers might improve electron transfer efficiency to specific contaminants like uranium or chromium.

  • Multi-subunit Optimization: Co-overexpression of nuoA2 with other key subunits of the NADH-quinone oxidoreductase complex could create a more robust electron transport system.

  • Regulatory Network Modification: Deletion of repressors like HgtR, which has been shown to regulate NADH dehydrogenase subunits in related Geobacter species, could lead to constitutive high-level expression of nuoA2 .

  • Synthetic Biology Approaches: Development of chimeric electron transport chains incorporating nuoA2 with components from other efficient metal reducers could create strains with novel or enhanced metal reduction capabilities. These approaches would need to be validated through careful physiological characterization and field testing to ensure that the enhanced strains maintain stability and activity under environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.