Recombinant Geobacter metallireducens NADH-quinone oxidoreductase subunit K 2 (nuoK2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK2; Gmet_3345; NADH-quinone oxidoreductase subunit K 2; NADH dehydrogenase I subunit K 2; NDH-1 subunit K 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)
Target Names
nuoK2
Target Protein Sequence
MVSLHSYLILSAILFSIGTIGVLIRRNAIVIFMCVEMMLNSVNLTFIALSKHLGNVDGQI FVFFVMTVAAAEAAVGLALMIAFYKNRESIDVEDIKLMRL
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The primary electron acceptor for the enzyme in this species is thought to be ubiquinone. This process couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Geobacter metallireducens and why is it significant for research?

Geobacter metallireducens is a metal-respiring bacterium with significant metabolic versatility compared to other members of the Geobacteraceae family. It is the second Geobacter species to have its complete genome sequenced, following G. sulfurreducens . The organism is notable for its ability to perform extracellular electron transfer (EET) reactions with various substrates, including solid-phase Fe(III)-containing minerals .

G. metallireducens has become an important model organism for studying novel aspects of extracellular electron exchange and anaerobic degradation of aromatic compounds . The genomic evidence suggests that its metabolism, physiology, and regulation of gene expression may differ dramatically from other Geobacteraceae, making it valuable for comparative studies .

What is the role of NADH-quinone oxidoreductase in Geobacter metallireducens?

NADH-quinone oxidoreductase (also known as Complex I) plays a crucial role in the electron transport chain of G. metallireducens. While specific information about nuoK2 is limited in available literature, the NADH-quinone oxidoreductase complex generally functions to couple electron transfer from NADH to quinone with proton translocation across the membrane.

In G. metallireducens, this process is particularly important given the organism's diverse electron transfer capabilities. The genome of G. metallireducens contains unique features related to electron transport that differ from G. sulfurreducens, including additional components for metabolism of organic acids and respiration . These differences may reflect adaptations to different ecological niches and electron acceptors available in the environment.

How does G. metallireducens differ from G. sulfurreducens in terms of metabolic capabilities?

G. metallireducens exhibits greater metabolic versatility compared to G. sulfurreducens. Genomic evidence reveals that G. metallireducens possesses more numerous genes for metabolism of organic acids including acetate, propionate, and pyruvate . While G. metallireducens lacks a dicarboxylic acid transporter, it has acquired a second putative succinate dehydrogenase/fumarate reductase complex, suggesting that respiration of fumarate was important in its evolutionary history .

Another significant difference is that G. metallireducens can derive biosynthetic reducing equivalents from the oxidative pentose phosphate pathway, whereas most Geobacteraceae obtain them from electron transfer pathways via a ferredoxin oxidoreductase . This metabolic distinction may have implications for energy conservation and redox balance during growth on different substrates.

What genetic systems are available for manipulating G. metallireducens to study nuoK2 function?

A genetic system has been developed for G. metallireducens by modifying the homologous recombination approach previously described for G. sulfurreducens. Critical modifications to achieve successful transformation include increasing the quantity of electrotransformed linear DNA by 3.5-fold and harvesting cells at early-log phase .

For gene deletion and replacement studies targeting nuoK2, researchers can implement the Cre-lox recombination system, which allows for the removal of antibiotic resistance cassettes from the G. metallireducens chromosome. This technique permits the generation of multiple mutations in the same strain , which is particularly valuable when studying complex electron transport pathways where multiple components may have overlapping functions.

Research methodology table for genetic manipulation of G. metallireducens:

MethodApplicationKey Considerations
Homologous recombinationGene deletion/replacementRequires 3.5x higher DNA quantity than G. sulfurreducens protocols
Cre-lox systemMarker removal for multiple mutationsEssential for creating strains with multiple gene deletions
Early-log harvestingOptimal cell preparationCritical timing factor for successful transformation
ElectrotransformationDNA delivery methodRequires optimization of electrical parameters

How can researchers design experiments to distinguish the specific role of nuoK2 from other components in the electron transport chain?

Designing experiments to elucidate the specific role of nuoK2 requires a systematic approach to distinguish its function from other components in the electron transport chain. Based on methodologies applied to study other electron transfer components in Geobacter species, the following experimental design is recommended:

  • Generate a nuoK2 deletion strain using the genetic system described for G. metallireducens .

  • Create complementation strains expressing wild-type and modified versions of nuoK2 to verify phenotypes and conduct structure-function analyses.

  • Implement a comparative approach by measuring the ability of wild-type and nuoK2 mutant strains to reduce different electron acceptors (Fe(III) oxides, anodes, etc.) under controlled conditions.

  • Combine genetic analyses with biochemical characterization of the NADH-quinone oxidoreductase complex with and without nuoK2.

Studies on other electron transfer components in Geobacter species have demonstrated that deletion of key genes can significantly impact specific electron transfer pathways. For example, deletion of omcE impaired bacterial ability to reduce ferrihydrite but had minimal impact on anode reduction, while deletion of omcS diminished both ferrihydrite reduction and co-culture formation with G. sulfurreducens . Similar methodological approaches could reveal specific functions of nuoK2.

What statistical approaches are most appropriate for analyzing data from nuoK2 functional studies?

For experiments comparing wild-type and nuoK2 mutant strains, the following statistical considerations are important:

  • Control over variability is essential for detecting treatment effects. Much of experimental design focuses on procedures for reducing variability—for example, selecting reliable dependent variables, providing uniform instructions and standardized experimental procedures, and controlling extraneous experimental stimuli .

  • When variability is large, it becomes more difficult to regard a measure of central tendency as a dependable guide to representative performance. This principle applies directly to detecting the effects of genetic modifications like nuoK2 deletion .

  • The task of detecting experimental effects is analogous to distinguishing radio signals in the presence of static—the experimental variable effects represent the signal, and variability represents the noise. A strong signal relative to the static is easily detected, but a weak signal may be lost in noise .

Appropriate statistical approaches table:

Data TypeRecommended TestApplication Scenario
Growth ratesRepeated measures ANOVAComparing growth curves of wild-type vs. mutant
Electron transfer ratesTwo-way ANOVAComparing reduction rates across multiple substrates
Gene expressionqPCR with ΔΔCT methodMeasuring compensatory gene expression in mutants
Protein activityEnzyme kinetics (Km/Vmax)Characterizing purified nuoK2 biochemical properties

What are the key considerations for expressing and purifying recombinant nuoK2 protein?

Expression and purification of recombinant Geobacter metallireducens NADH-quinone oxidoreductase subunit K 2 (nuoK2) presents several challenges that require specific methodological approaches:

  • Expression system selection: Given the membrane-associated nature of nuoK2, specialized expression systems capable of properly folding membrane proteins are recommended. E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) may be suitable starting points.

  • Solubilization strategy: Effective extraction of the protein from membranes requires optimization of detergent type and concentration. A screening approach testing multiple detergents (DDM, LDAO, etc.) at varying concentrations is advisable.

  • Purification protocol: A multi-step purification strategy beginning with affinity chromatography (using an engineered tag) followed by size exclusion chromatography typically yields the best results for membrane proteins.

  • Stability considerations: Buffer optimization to maintain protein stability during purification and subsequent assays is critical. Addition of specific lipids or detergent mixtures may be necessary to maintain the native conformation of nuoK2.

These methodological considerations are informed by approaches used for other membrane proteins in related organisms, though specific conditions will need to be optimized for nuoK2.

How can researchers effectively study the interaction between nuoK2 and other components of the NADH-quinone oxidoreductase complex?

Studying protein-protein interactions within the NADH-quinone oxidoreductase complex requires multiple complementary approaches:

  • In vivo cross-linking followed by mass spectrometry (XL-MS) can capture native interactions between nuoK2 and other subunits of the complex within the bacterial membrane.

  • Bacterial two-hybrid or split-reporter assays can be implemented to verify specific binary interactions between nuoK2 and candidate partner proteins.

  • Co-immunoprecipitation with antibodies against nuoK2 or tagged versions of the protein can identify interacting partners under various physiological conditions.

  • Comparative analysis of the NADH-quinone oxidoreductase complex assembly in wild-type versus nuoK2 deletion strains using blue native PAGE can reveal the role of nuoK2 in complex stability and formation.

  • Computational prediction of interaction sites based on homology modeling and protein docking can guide targeted mutagenesis experiments to verify key residues involved in subunit interactions.

These approaches should be implemented as complementary methods rather than relying on a single technique, as each has specific limitations and strengths.

What methods are most effective for studying the role of nuoK2 in extracellular electron transfer?

G. metallireducens is known for its ability to perform extracellular electron transfer to various substrates. To study the potential role of nuoK2 in this process, researchers should consider these methodological approaches:

  • Electrochemical analysis: Chronoamperometry and cyclic voltammetry can measure electron transfer to electrodes by wild-type versus nuoK2 mutant strains, providing quantitative data on electron transfer kinetics.

  • Fe(III) reduction assays: Comparing the rate and extent of Fe(III) reduction by wild-type and mutant strains provides insights into the role of nuoK2 in mineral reduction pathways. Studies on other electron transfer components have shown that deletion of key genes can significantly impair Fe(III) reduction capabilities .

  • Gene expression analysis: qRT-PCR and RNA-seq comparing expression profiles between wild-type and mutant strains under different electron acceptor conditions can reveal regulatory relationships and compensatory mechanisms.

  • Co-culture experiments: Following the methodologies used for studying other electron transfer components, co-culture experiments with G. sulfurreducens can assess whether nuoK2 plays a role in inter-species electron transfer .

  • Proteomic analysis: Comparing membrane protein profiles between wild-type and mutant strains can identify changes in the abundance of other electron transfer components that might compensate for nuoK2 deletion.

How should researchers approach contradictory results in nuoK2 studies?

When encountering contradictory results in nuoK2 studies, researchers should implement a systematic approach to resolve inconsistencies:

  • Verify experimental conditions: Minor variations in growth conditions, electron acceptor preparation, or strain background can significantly impact results in Geobacter studies. Standardize and document all experimental parameters thoroughly.

  • Implement multiple methodological approaches: As demonstrated in studies of other electron transfer components like omcS, omcE, and pilA-N, different electron acceptors can reveal distinct phenotypes for the same mutation . Using multiple assays provides a more complete functional picture.

  • Evaluate genetic background effects: The presence or absence of other genes can influence nuoK2 phenotypes. For example, in G. sulfurreducens, the hydrogenase gene hybL impacts the phenotypic effects of omcZ and pilA-N deletions in co-culture experiments .

  • Conduct literature-based meta-analysis: When contradictory results appear, systematic comparison with published data on related components or organisms can provide context and potential explanations.

  • Refine hypotheses: During scholarly research, it is common to encounter information that contradicts initial research statements. When this happens, researchers should try to find more information that confirms or denies the contradictory information and may need to revise their original research questions .

What are the best practices for integrating genetic, biochemical, and physiological data in nuoK2 research?

Integrating multiple data types requires careful consideration of how different experimental approaches provide complementary information about nuoK2 function:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.