Recombinant Geobacter metallireducens Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Overview of Undecaprenyl-diphosphatase (uppP)

Undecaprenyl-diphosphatase (uppP), also known as BacA, is an enzyme critical for bacterial cell wall biosynthesis. It catalyzes the dephosphorylation of undecaprenyl diphosphate (UP-P) to undecaprenyl phosphate (UP), a lipid carrier essential for peptidoglycan and teichoic acid synthesis. While extensively studied in pathogens like Escherichia coli and Staphylococcus aureus , its role in environmental bacteria such as Geobacter metallireducens remains less characterized.

Genomic and Functional Insights from Geobacter metallireducens

  • GC Content: The chromosomal GC content is 59.51%, while the plasmid is 52.48% .

  • Electron Transfer Mechanisms: Outer-surface c-type cytochromes and conductive pili are essential for extracellular electron transfer to metals like Fe(III) and Mn(IV) .

Comparative Analysis of UPPS/uppP Pathways

Though G. metallireducens’ uppP has not been directly studied, insights can be drawn from related research:

  • UPPS as a Drug Target: Inhibitors targeting undecaprenyl diphosphate synthase (UPPS), which synthesizes UP-P, show efficacy against S. aureus and E. coli (MIC ~0.43 µg/mL) . UPPS and uppP are sequential enzymes in the same pathway.

  • Antibiotic Resistance: UPPS inhibitors like compound 4 restore sensitivity to methicillin and vancomycin in resistant strains , highlighting the therapeutic potential of targeting lipid carrier biosynthesis.

Hypothetical Role of uppP in G. metallireducens

Given G. metallireducens’ unique adaptations:

  • Environmental Adaptation: The plasmid-encoded RelE/ParE protein stabilizes the bacterium under stress , suggesting regulatory mechanisms that could influence lipid carrier recycling.

  • Metal Respiration: Extracellular electron transfer relies on cytochromes (e.g., OmcB) and pili , but cell wall integrity—dependent on UP—may also affect biofilm formation or metal reduction efficiency.

Research Gaps and Future Directions

  • Genomic Annotation: No explicit uppP gene has been identified in G. metallireducens’ annotated genome .

  • Functional Studies: Heterologous expression of putative uppP homologs and biochemical assays are needed to confirm activity.

  • Bioremediation Applications: If uppP is essential for cell wall synthesis, its inhibition could affect G. metallireducens’ viability in subsurface environments where it remediates metals .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
uppP; Gmet_3133; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)
Target Names
uppP
Target Protein Sequence
MNPLHATVLGAIQGLTEVLPVSSSAHLILIPWLFGWPESGITFDVALHLGTLIALALYFR RDIAELVVNALSGLTGGAHSSATRLPWYIIAGCVPAAIVGKTLEEPIEAIFRANPAIIAA FLIGFGLLLALADTLGSKKSRMDQIDLKNAMMIGLAQCLALLPGVSRSGITITAALFLGF SRETAARFSFLLSLPIVAGAALLKVGHLVRHGVPEGELQPLLIGVGVSAVFGYVSVALLL KLVQRYSLYPFVWYRLLAGAGVLLFIFNQ
Uniprot No.

Target Background

Function

Function: Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.

Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Geobacter metallireducens and what ecological significance does it have?

Geobacter metallireducens is a deltaproteobacterium that holds significant ecological importance as the first isolated organism demonstrated to completely oxidize organic compounds coupled with Fe(III) reduction under anaerobic conditions. Isolated from Potomac River sediments, G. metallireducens has become a model organism for studying microbial metal reduction . This bacterium typically thrives in anaerobic, neutral pH environments where iron reduction is a dominant metabolic process. Its ecological significance stems from its ability to participate in biogeochemical cycling through metal reduction and potential applications in bioremediation of contaminated sites, particularly those containing uranium and other heavy metals .

What is Undecaprenyl-diphosphatase (uppP) and what role does it play in bacterial physiology?

Undecaprenyl-diphosphatase (uppP) is an integral membrane enzyme involved in the peptidoglycan biosynthesis pathway in bacteria. While specific information about uppP in G. metallireducens is limited in the provided search results, this enzyme generally catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, which serves as a lipid carrier for cell wall precursors. This recycling step is critical for maintaining continuous peptidoglycan synthesis and bacterial cell wall integrity, especially in environments where G. metallireducens must adapt to changing redox conditions. The enzyme represents an important component of bacterial physiology that may influence adaptation to diverse environments, including those with metals that G. metallireducens can reduce.

How does G. metallireducens differ from other Geobacter species like G. sulfurreducens?

G. metallireducens differs from other Geobacter species in several key aspects:

CharacteristicG. metallireducensG. sulfurreducens
Electron donorsCan oxidize aromatic compounds (toluene, phenol, p-cresol)Typically relies on acetate or hydrogen
Genetic adaptabilityFirst identified with capability to couple organic compound oxidation to Fe(III) reductionExtensively studied for extracellular electron transfer mechanisms
Metabolic versatilityCapable of reducing various metals including Fe(III), Mn(IV), and U(VI)Similar reduction capabilities but different electron donor preferences
Genome characteristicsContains genes enabling aromatic compound metabolismFirst Geobacter species to have its genome sequenced

Both species can participate in direct interspecies electron transfer (DIET), though their capabilities may differ based on the conductivity of their pili and surface cytochromes . G. metallireducens strain Aro-5, in which the wild-type pilin gene was replaced, showed reduced ability to reduce Fe(III) oxide and produced only low current densities, indicating the importance of conductive pili for its characteristic electron transfer capabilities .

What are the optimal conditions for expressing recombinant G. metallireducens uppP in laboratory settings?

When expressing recombinant G. metallireducens uppP, researchers should consider several methodological factors:

  • Expression System Selection: For membrane proteins like uppP, specialized expression systems such as those used for G. sulfurreducens may be adapted. Consider using E. coli strains optimized for membrane protein expression (C41/C43) or homologous expression in Geobacter species.

  • Growth Conditions:

    • Temperature: 30°C (standard for Geobacter cultivation)

    • Medium: Vitamin-free minimal medium containing acetate (20 mM) as electron donor

    • Atmosphere: Strictly anaerobic conditions

    • pH: Maintain at neutral values (approximately 7.0)

  • Induction Parameters: If using an inducible system, titrate inducer concentrations carefully to prevent formation of inclusion bodies, which is common with membrane proteins.

  • Verification Methods: Use Western blotting with appropriate antibodies or activity assays to confirm successful expression.

For experiments requiring genetic manipulation, adapt conjugation methods similar to those developed for G. sulfurreducens using the pBBR1MCS family of plasmids, which have been successfully transferred from E. coli to Geobacter . This approach would allow for controlled expression of uppP in its native or related cellular environment.

How should researchers design experimental controls when studying recombinant G. metallireducens uppP?

A robust experimental design for studying recombinant G. metallireducens uppP requires careful consideration of appropriate controls :

  • Negative Controls:

    • Empty vector transformants to account for effects of the expression system itself

    • Catalytically inactive uppP mutants (e.g., site-directed mutagenesis of active site residues)

    • Wild-type G. metallireducens without recombinant manipulations

  • Positive Controls:

    • Well-characterized uppP homologs from model organisms (e.g., E. coli uppP)

    • Purified uppP enzyme with confirmed activity (if available)

  • Experimental Variables to Control:

    • Redox conditions, which significantly affect Geobacter physiology

    • Metal concentrations in growth media

    • Cell density and growth phase at time of analysis

    • Membrane fraction preparation methods

  • Randomization and Replication:

    • Implement biological replicates (minimum n=3) from independent transformations

    • Include technical replicates for each biological sample

    • Randomize sample processing order to minimize systematic errors

  • Validation Approaches:

    • Complementation studies in uppP-deficient strains

    • In vitro enzyme activity assays with purified protein

    • Structural characterization to confirm proper folding

These controls help distinguish specific effects of uppP from background experimental variation and ensure that observed phenotypes are directly attributable to the recombinant protein's activity .

What techniques are most effective for purifying recombinant G. metallireducens uppP?

Purifying recombinant G. metallireducens uppP presents challenges typical of membrane proteins. Based on methodological principles, the following purification strategy is recommended:

  • Membrane Extraction:

    • Harvest cells during mid to late exponential phase

    • Disrupt cells by sonication or French press in buffer containing protease inhibitors

    • Collect membrane fraction through differential centrifugation (low-speed centrifugation to remove debris, followed by ultracentrifugation at ≥100,000×g to isolate membranes)

  • Solubilization Screening:

    • Test a panel of detergents at various concentrations including:

      • Mild detergents (DDM, LMNG)

      • Zwitterionic detergents (CHAPS, LDAO)

      • Novel amphipols or nanodiscs for maintaining stability

    • Determine optimal detergent using small-scale extractions and activity assays

  • Chromatographic Separation:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Ion exchange chromatography as a polishing step if needed

  • Quality Assessment:

    • SDS-PAGE and Western blotting to confirm purity

    • Mass spectrometry for identity confirmation

    • Circular dichroism to verify secondary structure integrity

    • Activity assays to confirm functional state

When designing constructs, consider adding a TEV protease cleavage site between the target protein and affinity tag to allow tag removal. Additionally, expressing the protein with fusion partners like MBP may improve solubility and expression levels.

What assay methods can accurately measure G. metallireducens uppP enzyme activity?

Several complementary assay approaches can be used to measure G. metallireducens uppP enzyme activity:

  • Colorimetric Phosphate Release Assay:

    • Principle: Quantification of inorganic phosphate released during undecaprenyl pyrophosphate dephosphorylation

    • Method: Malachite green or other phosphate detection reagents

    • Advantages: Simple, high-throughput compatible

    • Limitations: Potential interference from buffer components

  • HPLC-Based Substrate Conversion Assay:

    • Principle: Direct measurement of undecaprenyl pyrophosphate consumption and undecaprenyl phosphate formation

    • Method: Reverse-phase HPLC with UV or mass spectrometry detection

    • Advantages: Direct observation of both substrate decrease and product formation

    • Limitations: Requires specialized equipment and reference standards

  • Radiolabeled Substrate Assay:

    • Principle: Tracking conversion of 32P-labeled undecaprenyl pyrophosphate

    • Method: Thin-layer chromatography or liquid scintillation counting

    • Advantages: High sensitivity, quantitative

    • Limitations: Radiation safety concerns, specialized facilities required

  • Coupled Enzyme Assay:

    • Principle: Link uppP activity to a secondary reaction with easily detectable output

    • Method: Connect phosphate release to NADH oxidation via auxiliary enzymes

    • Advantages: Continuous real-time monitoring

    • Limitations: Potential interference from coupling enzymes

For each assay, establish proper controls including:

  • Heat-inactivated enzyme

  • Reactions without substrate

  • Reactions with known inhibitors (e.g., bacitracin)

Optimize reaction conditions by titrating enzyme concentration, substrate concentration, pH, temperature, and divalent cation requirements. A combination of these methods provides the most comprehensive assessment of enzyme activity and kinetic parameters.

How does the electron transfer capability of G. metallireducens affect the function of membrane-associated enzymes like uppP?

The electron transfer capabilities of G. metallireducens may have complex interactions with membrane-associated enzymes like uppP through several mechanisms:

  • Membrane Potential Effects: G. metallireducens possesses exceptional extracellular electron transfer capabilities mediated through conductive pili and outer membrane cytochromes . These electron transfer processes generate proton gradients across the membrane that may influence the local environment and activity of membrane-embedded enzymes like uppP. Research with G. metallireducens strain Aro-5, which has poorly conductive pili, demonstrates how altered electron transfer capabilities affect cellular functions .

  • Redox State Influence: The cellular redox state, which is directly affected by G. metallireducens' metal-reducing activity, could potentially modulate uppP activity through:

    • Direct effects on any redox-sensitive residues within the enzyme

    • Alterations in membrane lipid composition as cellular response to redox changes

    • Modified substrate availability due to related metabolic shifts

  • Metal Ion Interactions: As G. metallireducens reduces metal ions like Fe(III), Mn(IV), and U(VI), local concentrations of reduced forms (Fe(II), Mn(II), U(IV)) increase. These reduced metal ions could interact with uppP in several ways:

    • Serving as potential cofactors or inhibitors

    • Altering membrane properties through interaction with lipid headgroups

    • Creating precipitates (particularly with uranium) that may physically affect membrane protein function

  • Vesicle Formation Considerations: G. metallireducens produces outer membrane vesicles as part of its response to uranium exposure . This vesicle formation process involves membrane remodeling that could potentially alter the distribution and activity of membrane proteins like uppP. Whether this represents a general stress response applicable to other conditions requires further investigation.

Advanced research in this area should employ techniques such as membrane potential measurements, redox state monitoring, and metal speciation analysis alongside uppP activity assays to establish correlations between electron transfer capabilities and enzyme function.

What structural features of G. metallireducens uppP contribute to its activity in different redox environments?

Although specific structural information about G. metallireducens uppP is not provided in the search results, we can propose key structural features likely to influence its function in varying redox environments based on general principles of membrane enzyme structure-function relationships:

  • Transmembrane Domain Organization:

    • Typical bacterial uppP enzymes contain multiple transmembrane helices that form a hydrophobic channel for substrate access

    • The precise arrangement of these helices may create microenvironments that protect the catalytic site from direct exposure to redox changes

    • Comparative modeling with homologous structures could predict transmembrane topology specific to G. metallireducens uppP

  • Catalytic Site Composition:

    • Active site residues likely include conserved aspartic acid residues that coordinate divalent cations (Mg2+ or Mn2+)

    • Presence of redox-sensitive amino acids (cysteine, methionine) near the active site would make the enzyme directly responsive to environmental redox changes

    • Site-directed mutagenesis experiments targeting these residues could confirm their roles in redox sensitivity

  • Metal Coordination Sites:

    • Given G. metallireducens' metal-reducing capabilities, its uppP may have evolved specific features for functioning in metal-rich environments

    • Potential adaptation mechanisms include:

      • Additional metal coordination sites that stabilize the protein in metal-rich conditions

      • Altered substrate binding pocket that maintains function despite metal interference

      • Structural elements that prevent inhibition by reduced metals

  • Conformational Flexibility:

    • Dynamic regions that allow the enzyme to alternate between different conformational states

    • These conformational changes may be influenced by redox conditions or metal binding

    • Techniques like hydrogen-deuterium exchange mass spectrometry could map these flexible regions

Research approaches to investigate these structural features might include:

  • Homology modeling based on known bacterial uppP structures

  • Site-directed mutagenesis of predicted key residues

  • Expression in different redox backgrounds with activity measurement

  • Structural studies using X-ray crystallography or cryo-EM under various redox conditions

How can researchers effectively integrate uppP studies with investigations of G. metallireducens' electron transfer mechanisms?

To effectively integrate studies of uppP with G. metallireducens' electron transfer mechanisms, researchers should consider the following methodological approaches:

  • Mutant Complementation Studies:

    • Create uppP deletion or knock-down strains in G. metallireducens

    • Assess how uppP mutation affects electron transfer capabilities using techniques such as:

      • Measurement of Fe(III) reduction rates

      • Quantification of current production in microbial fuel cells

      • Analysis of direct interspecies electron transfer (DIET) in co-cultures

    • Complement with wild-type and modified uppP variants to correlate specific protein features with electron transfer phenotypes

  • Membrane Composition Analysis:

    • Investigate how uppP activity influences membrane lipid composition

    • Assess whether changes in undecaprenyl phosphate pools affect:

      • Distribution and function of outer membrane cytochromes

      • Assembly and conductivity of type IV pili

      • Formation of membrane vesicles involved in uranium sequestration

  • Co-localization Experiments:

    • Use fluorescence microscopy with tagged proteins to determine if uppP co-localizes with components of the electron transfer machinery

    • Implement techniques like FRET to assess proximity relationships

    • Correlate spatial distribution patterns with electron transfer efficiency

  • Systems Biology Approach:

    • Perform transcriptomic and proteomic analyses to identify co-regulation patterns between uppP and electron transfer components

    • Use metabolic flux analysis to connect peptidoglycan synthesis (involving uppP) with electron transfer pathways

    • Develop computational models that integrate cell wall processes with extracellular electron transfer

  • Environmental Response Studies:

    • Examine how different environmental conditions affect both uppP activity and electron transfer simultaneously

    • Design experiments that manipulate factors such as:

      • Redox potential

      • Metal ion availability

      • Carbon source type and concentration

      • Presence of potential electron acceptors or DIET partners

By implementing these integrated approaches, researchers can develop a more comprehensive understanding of how fundamental cellular processes like cell wall biosynthesis (involving uppP) interact with specialized metabolic capabilities like extracellular electron transfer in G. metallireducens.

What are the most common difficulties in working with recombinant G. metallireducens proteins, and how can they be overcome?

Researchers working with recombinant G. metallireducens proteins, particularly membrane-associated enzymes like uppP, commonly encounter several challenges:

  • Anaerobic Expression Challenges:

    • Problem: G. metallireducens is strictly anaerobic, complicating protein expression

    • Solution: Establish reliable anaerobic chambers for all experimental procedures or adapt expression to facultative anaerobic hosts with appropriate controls for proper folding

  • Low Transformation Efficiency:

    • Problem: Difficulty in introducing recombinant DNA into Geobacter species

    • Solution: Implement optimized conjugation protocols using E. coli WM3064 as donor strain with plasmids like pBBR1MCS; maintain strictly anaerobic conditions during conjugation

  • Protein Misfolding:

    • Problem: Membrane proteins often misfold when overexpressed

    • Solution: Reduce expression temperature to 16-20°C; use specialized E. coli strains (C41/C43); consider fusion partners (MBP, SUMO) to improve folding

  • Protein Inactivity After Purification:

    • Problem: Loss of enzyme activity during extraction from membrane

    • Solution: Screen multiple detergents at minimal effective concentrations; consider native nanodiscs or amphipol systems to maintain the native lipid environment

  • Inconsistent Growth Conditions:

    • Problem: Variable growth rates affecting protein expression

    • Solution: Standardize inoculum preparation; monitor growth curves carefully; harvest at consistent optical density rather than fixed time points

  • Metal Interference With Assays:

    • Problem: Metal ions affecting protein activity measurements

    • Solution: Include appropriate chelating agents in buffers; perform metal speciation analysis; develop controls with defined metal concentrations

  • Oxygen Sensitivity:

    • Problem: Protein degradation or inactivation due to oxygen exposure

    • Solution: Add reducing agents (DTT, β-mercaptoethanol) to buffers; perform all procedures in anaerobic chamber; use oxygen-scavenging enzyme systems

A systematic approach to troubleshooting involves:

  • Beginning with small-scale optimization experiments

  • Implementing one change at a time to identify effective solutions

  • Developing robust positive controls to validate each experimental step

  • Considering alternative expression systems if traditional approaches fail

How can researchers distinguish between effects of uppP activity and other physiological processes in G. metallireducens?

Distinguishing between effects specifically attributable to uppP activity versus other physiological processes in G. metallireducens requires careful experimental design and multiple lines of evidence:

  • Genetic Manipulation Approaches:

    • Create clean deletion mutants of uppP using techniques adapted from G. sulfurreducens genetic systems

    • Develop inducible expression systems allowing titration of uppP levels

    • Implement CRISPR-Cas9 for precise genome editing to create point mutations affecting only uppP activity

    • Use these genetic tools to create a gradient of uppP activity levels for dose-response analysis

  • Complementation Tests:

    • Rescue deletion phenotypes with:

      • Wild-type uppP (should restore normal function)

      • Catalytically inactive uppP (should not restore function)

      • uppP from other species (may partially restore function)

    • This approach helps confirm that observed phenotypes are specifically due to uppP function

  • Metabolic Labeling Experiments:

    • Use radioactive or stable isotope labeled precursors to track specific pathways

    • Compare flux through peptidoglycan synthesis pathway in wild-type versus uppP-modified strains

    • Implement pulse-chase experiments to distinguish effects on synthesis versus turnover

  • High-Resolution Phenotyping:

    • Employ techniques that can detect subtle changes in:

      • Cell morphology (electron microscopy, atomic force microscopy)

      • Membrane properties (fluorescence anisotropy, lateral diffusion measurements)

      • Cell wall composition (HPLC analysis of muropeptides)

    • Correlate these phenotypes with measured uppP activity levels

  • Temporal Studies:

    • Monitor physiological changes after rapid induction or inhibition of uppP

    • Early changes are more likely directly related to uppP function

    • Later changes may represent secondary effects or compensatory responses

  • Chemical Genetic Approach:

    • Use specific inhibitors of uppP (if available) and compare effects to genetic manipulation

    • Implement suppressor screens to identify genes that can compensate for uppP dysfunction

    • These approaches help map the network of interactions involving uppP

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Use statistical approaches to distinguish direct versus indirect effects

    • Network analysis to identify processes most closely linked to uppP function

By implementing these complementary approaches, researchers can build a comprehensive understanding of uppP function that distinguishes its specific role from broader physiological effects in G. metallireducens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.