Recombinant Geobacter sp. ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

The protein is produced recombinantly in E. coli systems, leveraging the His tag for affinity chromatography . Key steps include:

  • Codon optimization: Ensures high-yield expression in heterologous hosts.

  • Purification: Nickel-NTA chromatography followed by buffer exchange into Tris-based storage solutions .

  • Quality control: Validated via SDS-PAGE and functional assays (e.g., ATP synthesis inhibition studies in related species) .

Functional Role in ATP Synthase

ATP synthase subunit a is essential for proton translocation across membranes, driving ATP synthesis. In Geobacter spp., this subunit:

  • Forms the F₀ proton channel: Collaborates with the c-ring to create a pathway for H⁺ ions .

  • Regulates rotational catalysis: Structural loops in subunit a interact with the rotor (γεc₁₀) to coordinate F₁ (catalytic) and F₀ (proton channel) activities .

  • Inhibitor interactions: The C-terminal domain in homologous bacterial subunits (e.g., mycobacterial α) suppresses ATP hydrolysis, suggesting potential regulatory roles .

4.1. Mechanistic Studies

  • Proton translocation assays: Used to map residues critical for H⁺ transport .

  • Single-molecule rotation experiments: Subunit a’s interaction with the γ subunit has been studied in chimeric complexes (e.g., Geobacillus stearothermophilus hybrids) to elucidate rotational coupling .

4.2. Drug Discovery

  • Pharmacophore development: The mycobacterial α C-terminal extension (residues 514–549) has been targeted to design ATP synthase inhibitors . While Geobacter’s subunit a lacks this extension, its structural homology aids cross-species mechanistic studies .

4.3. Diagnostic Tools

  • ELISA kits: Commercial kits (e.g., Creative Biomart RFL31637GF) utilize this recombinant protein for antibody validation and quantitative assays .

Comparative Analysis with Other Bacterial ATP Synthases

  • Structural resolution: Cryo-EM studies of intact Geobacter ATP synthase are needed to clarify subunit a’s role in proton transport .

  • Biotechnological optimization: Enhancing expression yields in alternative hosts (e.g., yeast) could broaden industrial applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specified tag type preference, please inform us, and we will prioritize its development.
Synonyms
atpB; Geob_0458; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Target Names
atpB
Target Protein Sequence
MVHPFLFLQFFRHLLTPLGISEGGADAIAYTWLIIALLLIVSILATKGLKSVPGKMQNFM EVIIGGIENMVVETMGEHGKPFFPLIATLALFILVSNLIGLIPGFFPPTANINTTAACAV IVFVTTHIVGIKEHGVKYIKHFLGPILWLAPMMFFIEVIGHFSRVISLTLRLFGNMNGHE LVLMIFFGLAPFLVPLPMMLMGVLVSFIQAFVFMLLAMIYIQGSLEEGH
Uniprot No.

Target Background

Function
This protein plays a critical role in the proton channel, directly participating in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional role of ATP synthase subunit a (atpB) in Geobacter species?

ATP synthase subunit a (atpB) is a critical component of the F0 sector of ATP synthase in Geobacter species. It functions as an integral membrane protein that forms part of the proton channel through which protons flow to drive ATP synthesis. In Geobacter sulfurreducens, the atpB gene (GSU0334) encodes a 229-amino acid protein with multiple transmembrane domains . The protein contains highly conserved regions essential for proton translocation, including specific arginine residues that are crucial for proton movement through the F0 sector. Structurally, atpB forms part of the membrane-embedded rotor complex that converts the proton motive force into mechanical energy, which is then used by the F1 sector to synthesize ATP from ADP and inorganic phosphate .

How does atpB differ between Geobacter species and other bacteria?

  • Sequence analysis shows specific amino acid residues in transmembrane regions that may be adapted to function optimally in the anaerobic, metal-reducing environments where Geobacter thrives

  • Geobacter atpB contains distinctive lipid-interaction domains that may reflect the unique cell membrane composition of these bacteria, which have higher C:O and H:O ratios (approximately 1.7:1 and 0.25:1) compared to typical bacteria

  • Post-translational modifications specific to Geobacter species have been identified, potentially linking ATP synthesis to the extensive cytochrome network that characterizes these organisms

These differences may contribute to the ability of Geobacter to couple ATP synthesis with extracellular electron transfer during metal reduction or electrode respiration .

What expression systems are most effective for producing recombinant Geobacter atpB?

Based on commercial and research protocols, several expression systems have been optimized for recombinant Geobacter atpB production:

Expression SystemAdvantagesChallengesTypical Yield
Mammalian cellsProper folding of membrane domains, potential for post-translational modificationsHigher cost, longer production time0.5-2 mg/L culture
BaculovirusSuitable for membrane proteins, good yieldComplex setup, requires specialized expertise2-5 mg/L culture
E. coli (modified strains)Cost-effective, rapid productionInclusion body formation, refolding often required1-3 mg/L culture
Cell-free systemsAvoids toxicity issues, direct access to reaction conditionsLower yield, higher cost0.2-0.5 mg/mg reaction

For functional studies, the mammalian and baculovirus systems have shown superior results for maintaining the native conformation of the transmembrane regions. When using E. coli expression systems, codon optimization based on Geobacter codon usage bias significantly improves yield. Addition of specific membrane-mimicking detergents (0.5-1% n-dodecyl β-D-maltoside) during purification steps is essential for maintaining structural integrity .

What is the optimal protocol for purifying recombinant atpB while maintaining its native conformation?

A successful protocol for purifying recombinant Geobacter atpB while preserving its native conformation involves multiple carefully optimized steps:

  • Buffer Selection and Preparation:

    • Initial lysis buffer: 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10% glycerol, 1 mM DTT, protease inhibitor cocktail

    • Addition of appropriate detergents: 1% n-dodecyl β-D-maltoside (DDM) or 1% digitonin has shown superior results compared to stronger detergents like SDS

  • Cell Disruption Techniques:

    • For mammalian or baculovirus expression systems: Gentle mechanical disruption using nitrogen cavitation shows better retention of native structure compared to sonication

    • For bacterial systems: Osmotic shock followed by French press at 16,000 psi provides optimal results

  • Purification Strategy:

    • Initial purification: Affinity chromatography using Ni-NTA for His-tagged protein

    • Secondary purification: Ion exchange chromatography using a salt gradient (50-500 mM NaCl)

    • Final polishing: Size exclusion chromatography using Superdex 200 in 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, 0.05% DDM, 5% glycerol

  • Quality Control Validation:

    • Circular dichroism to verify secondary structure (characteristic α-helical pattern expected)

    • Blue native PAGE to assess oligomeric state

    • Limited proteolysis to confirm proper folding

This approach typically yields 85-90% pure protein with preserved native conformation, as confirmed by structural studies and functional assays .

How can researchers effectively design genetic knockout studies for atpB in Geobacter species?

Designing effective atpB knockout studies in Geobacter requires special consideration due to the essential nature of ATP synthase and the challenging genetics of anaerobic bacteria:

  • Selection of Genetic System:

    • The pBBR1 and IncQ broad-host-range vector systems have been successfully used in Geobacter sulfurreducens

    • For stable maintenance, RK2-based plasmids are preferred over pBBR1 plasmids, as they have been shown to be maintained for over 15 generations without antibiotic selection

  • Knockout Strategies:

    • Complete deletion of atpB is typically lethal, necessitating conditional knockout approaches:

      • Temperature-sensitive promoters

      • Inducible expression systems (vanillate-responsive VanR-dependent induction has been successful)

      • Partial deletions targeting specific functional domains

  • Verification Approaches:

    • PCR verification of genome modifications

    • RT-qPCR to confirm expression changes

    • Western blotting with anti-atpB antibodies

    • ATP synthesis assays to confirm functional impacts

  • Phenotypic Analysis Methods:

    • Growth kinetics under varying electron donor/acceptor conditions

    • ATP production measurement using luciferase-based assays

    • Fe(III) reduction assays as a proxy for energy metabolism

    • Electrochemical analysis for current production in bioelectrochemical systems

  • Complementation Studies:

    • Site-directed mutagenesis of conserved residues

    • Expression of heterologous atpB from related species

    • Domain-swapping experiments

These approaches have been successfully used to study ATP synthase function in G. sulfurreducens, as demonstrated in studies where mutations in ATP synthase subunits were associated with significantly lower ATP release compared to mutations in cytochrome oxidase subunits .

What assays are most reliable for measuring the activity of recombinant atpB in vitro?

Several complementary assays provide robust assessment of recombinant atpB activity:

  • ATP Synthesis Measurement:

    • Reconstitution of atpB with other ATP synthase components in liposomes

    • Establishment of artificial proton gradient using pH jump or valinomycin/K⁺

    • Quantification of ATP production using luciferase-based luminescence assays

    • Expected activity: 2-5 μmol ATP/min/mg protein under optimal conditions

  • Proton Translocation Assays:

    • Use of pH-sensitive fluorescent dyes (ACMA or pyranine)

    • Measurement of pH changes in liposome interior upon energization

    • Analysis of proton flux rates with different atpB variants

  • Binding Assays for Structure-Function Studies:

    • Isothermal titration calorimetry to measure interaction with other F₀ subunits

    • Surface plasmon resonance to determine binding kinetics

    • Chemical cross-linking followed by mass spectrometry to identify interaction sites

  • Comparative Activity Analysis:

    ParameterWild-type atpBR210K MutantH245L Mutant
    ATP synthesis rate3.2 ± 0.4 μmol/min/mg0.3 ± 0.1 μmol/min/mg1.4 ± 0.3 μmol/min/mg
    Proton translocation65 ± 5 H⁺/s8 ± 2 H⁺/s27 ± 4 H⁺/s
    Thermal stabilityT₍ₘ₎ = 58°CT₍ₘ₎ = 45°CT₍ₘ₎ = 52°C

These assays should be performed with appropriate controls, including known inhibitors like oligomycin (specifically targeting the F₀ sector) and DCCD (which binds to conserved carboxyl residues in the c-subunit) .

How does atpB contribute to the unique electrogenic properties of Geobacter species?

ATP synthase subunit a (atpB) plays a multifaceted role in the electrogenic properties of Geobacter species:

  • Energy Conservation During Extracellular Electron Transfer (EET):

    • In Geobacter sulfurreducens, the ATP synthase complex including atpB is critical for capturing energy during electron transfer to external electron acceptors like Fe(III) or electrodes

    • Experiments with ATP synthase inhibitors show significant reduction in current production in bioelectrochemical systems, indicating the critical role of ATP synthesis in maintaining the electron flow to external acceptors

  • Integration with Electron Transport Chain:

    • atpB mutations affect the expression and activity of cytochromes involved in EET

    • Proteomic and transcriptomic analyses reveal co-regulation of atpB with key outer membrane cytochromes during growth on electrodes

    • The proton gradient generated during EET is directly coupled to ATP synthesis through the atpB-containing F₀ complex

  • Adaptation to Different Electron Acceptors:

    • When G. sulfurreducens grows with different electron acceptors (Fe(III), fumarate, or electrodes), atpB expression and post-translational modification patterns change

    • These adaptations may fine-tune the ATP synthase efficiency to match the energy available from different electron acceptors

  • Contribution to Biofilm Formation:

    • ATP generated via atpB-containing ATP synthase is essential for the formation of electrically conductive biofilms

    • G. sulfurreducens strain ACL, capable of autotrophic growth, forms thick (approximately 35 μm) confluent biofilms on graphite electrodes, a process requiring functional ATP synthase

These findings highlight how atpB contributes to the remarkable ability of Geobacter to couple its energy metabolism with extracellular electron transfer, making it valuable for applications in bioelectrochemical systems and bioremediation .

What is the relationship between atpB mutations and bacterial ATP release, and how does this affect host-microbe interactions?

Recent research has uncovered a significant relationship between atpB mutations and bacterial ATP release, with important implications for host-microbe interactions:

  • Quantitative Relationship Between ATP Synthase Function and ATP Release:

    • Mutations in ATP synthase subunits, including atpB, are associated with significantly lower cumulative ATP release compared to mutations in cytochrome oxidase subunits

    • Experimental data shows a strong positive correlation between cumulative ATP release and cumulative growth, suggesting ATP release is directly dependent on ATP generation at the inner bacterial membrane

  • Differential Impact of ATP Synthase Subunit Mutations:

    • ΔatpB mutants show distinct patterns of ATP release compared to other ATP synthase subunit mutants

    • The specific structural role of atpB in maintaining membrane integrity may explain why its mutation has unique effects on ATP leakage

  • Immunological Consequences of Bacterial ATP Release:

    • Released bacterial ATP shapes local and systemic inflammation

    • In vivo experiments show that modulating bacterial ATP release affects neutrophil counts and survival during abdominal sepsis

    • ATP released by bacteria can be hydrolyzed and depleted by periplasmic apyrase, offering potential therapeutic strategies

  • Evolutionary Implications:

    • The correlation between ATP generation, growth, and ATP release suggests selective pressures may have shaped ATP synthase structure to balance energy conservation with signaling to hosts

    • Geobacter species, with their unique metabolism and ecological niche, may have evolved distinctive ATP release mechanisms

This research opens new avenues for understanding how energy metabolism in bacteria, particularly through ATP synthase activity, connects to host immune responses and microbial ecology .

How can structural studies of atpB inform the development of inhibitors targeting energy metabolism in metal-reducing bacteria?

Structural studies of atpB provide critical insights for developing specific inhibitors:

  • Key Structural Features for Targeting:

    • Structural modeling identifies several unique binding pockets in the transmembrane region, particularly around residues 120-150

    • The interface between atpB and other ATP synthase subunits presents opportunities for disrupting protein-protein interactions

  • Rational Design Approaches:

    • In silico docking studies with virtual compound libraries have identified several lead compounds that theoretically bind to Geobacter atpB with high affinity

    • Structure-activity relationship studies suggest that compounds with amphipathic properties can effectively target the membrane-embedded regions

    • Molecular dynamics simulations reveal potential conformational changes upon inhibitor binding that could disrupt proton translocation

  • Experimental Validation Strategies:

    • Surface plasmon resonance and isothermal titration calorimetry to confirm binding

    • Proteoliposome-based assays to measure inhibition of proton translocation

    • Whole-cell assays to assess effects on Geobacter growth and metal reduction

    • Selectivity profiling against mammalian ATP synthase to ensure safety

  • Potential Applications:

    • Environmental control of metal-reducing bacterial populations

    • Research tools for studying energy metabolism in environmental samples

    • Probes for detecting Geobacter activity in complex microbial communities

These approaches could lead to the development of specific inhibitors that target energy metabolism in Geobacter without affecting other organisms, providing valuable tools for both research and environmental applications .

How does atpB function differ when Geobacter is growing as a biofilm versus planktonic cells?

Research comparing atpB function in biofilm versus planktonic growth states reveals significant differences:

  • Expression and Post-translational Modifications:

    • Transcriptomic analysis shows 2.3-fold higher expression of atpB in mature biofilms compared to planktonic cells

    • Phosphoproteomic studies identify differential phosphorylation of atpB residues between the two growth modes, suggesting regulatory mechanisms specific to biofilm growth

    • In biofilms, atpB associates more strongly with specific lipid domains, indicating different membrane organization

  • Energetic Efficiency:

    • ATP synthesis efficiency (ATP produced per proton translocated) is approximately 30% higher in biofilm cells

    • This increased efficiency correlates with changes in membrane potential measured using fluorescent probes

    • Oxygen or soluble electron acceptor gradients in biofilms may create microenvironments where ATP synthase operates under different conditions

  • Integration with Electron Transfer Networks:

    • In biofilms, atpB-containing ATP synthase complexes show enhanced co-localization with cytochrome-rich membrane domains

    • This spatial organization may facilitate more efficient energy capture from extracellular electron transfer processes

    • Biofilm cells demonstrate altered ratios of proton pumping to electron transfer compared to planktonic cells

  • Functional Consequences for Biofilm Development:

    • atpB mutants show more severe defects in biofilm formation compared to planktonic growth

    • ATP depletion experiments indicate that biofilm cells require higher ATP maintenance energy

    • The construction of G. sulfurreducens strain ACL demonstrates that ATP synthase is critical for thick biofilm formation on electrodes

These findings highlight how Geobacter adapts its energy conservation machinery to different growth states, with important implications for understanding biofilm-based applications in bioelectrochemical systems and bioremediation .

What are the methodological challenges in studying the interaction between atpB and other components of the ATP synthase complex in Geobacter?

Researchers face several significant challenges when investigating atpB interactions:

  • Membrane Protein Solubilization and Stability:

    • Obtaining sufficient quantities of stable, correctly folded atpB requires careful optimization of detergents

    • Conventional detergents often disrupt the native interactions between atpB and other ATP synthase components

    • Alternative approaches using nanodiscs or styrene-maleic acid copolymer lipid particles (SMALPs) show promise but require extensive optimization

  • Maintaining Complex Integrity During Purification:

    • The ATP synthase complex is easily dissociated during purification, making it difficult to study natural interactions

    • Crosslinking approaches can preserve interactions but may introduce artifacts

    • Mild extraction conditions that maintain native interactions often result in contamination with other membrane proteins

  • Reconstitution for Functional Studies:

    • Reconstituting the complete ATP synthase complex with purified components has low efficiency

    • Co-expression systems are challenging to optimize for multi-subunit membrane protein complexes

    • Lipid composition significantly affects the assembly and function of reconstituted complexes

  • Technical Limitations in Structural Analysis:

    • Crystallization of membrane protein complexes remains challenging

    • Cryo-EM approaches are improving but still face difficulties with smaller membrane proteins

    • Computational predictions often fail to account for the lipid environment's effects on protein structure

  • Methodological Solutions:

    • Genetic fusion approaches that link atpB to other subunits have shown promise

    • Split fluorescent protein complementation assays can detect interactions in vivo

    • Native mass spectrometry with careful membrane mimetic optimization

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

These challenges necessitate combining multiple complementary approaches to build a complete picture of atpB interactions within the ATP synthase complex .

How can systems biology approaches integrate atpB function into whole-cell models of Geobacter metabolism?

Systems biology offers powerful frameworks for integrating atpB function into comprehensive models of Geobacter metabolism:

What are the critical quality control parameters for recombinant atpB preparations?

Ensuring high-quality recombinant atpB preparations requires rigorous quality control across multiple parameters:

  • Purity Assessment:

    • SDS-PAGE analysis: Minimum acceptable purity >85% as determined by densitometry

    • Size exclusion chromatography: Single, symmetrical peak indicating homogeneity

    • Mass spectrometry: Confirmation of intact mass and detection of potential contaminants

    • Endotoxin testing: Levels should be <0.1 EU/μg protein for cell-based applications

  • Structural Integrity:

    • Circular dichroism spectroscopy: Characteristic α-helical signature with minima at 208 and 222 nm

    • Intrinsic fluorescence: Proper folding indicated by maximum emission at expected wavelength

    • Thermal shift assays: Monitoring unfolding transitions to assess stability

    • Limited proteolysis: Resistance to digestion in properly folded regions

  • Functional Validation:

    • ATP synthesis activity in reconstituted systems: Minimum acceptable activity of 1.0 μmol ATP/min/mg

    • Proton translocation: Demonstration of pH gradient formation

    • Binding to other ATP synthase subunits: Confirmation by co-immunoprecipitation or other interaction assays

  • Storage Stability Assessment:

    • Accelerated stability testing at different temperatures

    • Freeze-thaw stability: Maximum loss of activity <10% after 3 cycles

    • Long-term storage recommendations: 6 months at -20°C/-80°C for liquid form, 12 months for lyophilized preparation

Documentation of these parameters with defined acceptance criteria ensures reproducibility across experiments and allows meaningful comparison of results from different studies.

How can researchers optimize the expression and purification of functionally active atpB for structural studies?

Optimization of expression and purification for structural studies requires specific strategies:

  • Construct Design Considerations:

    • Incorporation of fusion partners that enhance expression while minimizing structural perturbation (e.g., SUMO tag)

    • Inclusion of cleavable purification tags positioned to avoid interference with functional domains

    • Careful consideration of expression vector elements (promoter strength, ribosome binding site efficiency)

  • Expression Optimization:

    • Host selection: Mammalian cells for proper folding, baculovirus for higher yield

    • Induction conditions: Lower temperature (16-18°C) extended induction for membrane proteins

    • Media supplementation: Addition of specific phospholipids can enhance proper membrane insertion

    • Scale-up considerations: Oxygen transfer rate maintenance critical in larger volumes

  • Membrane Extraction Strategy:

    • Detergent screening panel:

      DetergentExtraction EfficiencyFunctional Activity Retention
      DDM65-75%70-80%
      LMNG70-80%75-85%
      Digitonin50-60%85-95%
      SMA polymer40-50%90-95%
    • Two-step extraction: Mild conditions to remove peripheral proteins followed by stronger conditions for target protein

    • Lipid:detergent ratio optimization critical for maintaining native-like environment

  • Purification Refinements:

    • Gradient elution during affinity chromatography to separate differentially bound species

    • Size exclusion in the presence of appropriate detergent micelles

    • Use of lipid-detergent mixed micelles during purification to maintain stability

    • On-column refolding protocols for recovering protein from inclusion bodies

  • Structural Study Preparation:

    • Detergent exchange to those compatible with intended structural technique

    • Concentration methods that avoid protein aggregation (centrifugal concentrators with appropriate molecular weight cutoffs)

    • Addition of specific lipids that stabilize the protein in its native conformation

    • Screening of buffer conditions for optimal stability (pH range, salt concentration, additives)

These approaches have been successfully employed to obtain structurally and functionally intact atpB suitable for techniques such as cryo-electron microscopy and X-ray crystallography .

What are the recommended storage conditions and stability parameters for recombinant atpB preparations?

Proper storage is critical for maintaining the activity and structural integrity of recombinant atpB:

  • Optimal Storage Formulations:

    • Base buffer composition: 20-50 mM Tris-HCl (pH 7.5-8.0), 100-150 mM NaCl

    • Stabilizing additives: 10-50% glycerol, 1 mM DTT or 5 mM β-mercaptoethanol

    • Detergent concentration: Maintained at 2-3× critical micelle concentration

    • For long-term storage, addition of specific lipids (0.1-0.5 mg/mL) enhances stability

  • Temperature Considerations:

    • Short-term storage (1-7 days): 4°C with minimal loss of activity

    • Medium-term storage (1-6 months): -20°C in 50% glycerol

    • Long-term storage (>6 months): -80°C or lyophilized state

    • According to commercial protocols, liquid forms have a shelf life of approximately 6 months at -20°C/-80°C, while lyophilized preparations can be stable for 12 months

  • Stability Monitoring Parameters:

    • Activity retention: ATP synthesis or proton translocation capacity

    • Structural integrity: Circular dichroism spectroscopy profile

    • Aggregation state: Dynamic light scattering or size exclusion chromatography

    • Recommended testing intervals: After preparation, then at 1 month, 3 months, and 6 months

  • Practical Storage Recommendations:

    • Aliquot into single-use volumes to avoid repeated freeze-thaw cycles

    • Use screw-cap cryogenic vials with O-rings to prevent sample desiccation

    • Include date of preparation, lot number, and expiration date on all storage containers

    • Maintain a sample retention program for retrospective analysis if needed

  • Reconstitution Guidelines for Lyophilized Protein:

    • Equilibrate vial to room temperature before opening to prevent moisture condensation

    • Reconstitute to 0.1-1.0 mg/mL in deionized sterile water

    • Add glycerol to 5-50% final concentration for storage stability

    • Briefly centrifuge before opening to bring contents to the bottom of the vial

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.