Recombinant Geobacter sp. Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mscL; Geob_0331; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Target Names
mscL
Target Protein Sequence
MFKEFKEFAVKGNAVDLAVGVIIGAAFGKIVTSLVNDILMPPLGLLTGKMDFSNLFINLS GTPVDTVAKAKAAGIPTINYGLFFNNIIDFVLVAFSVFLVVKQINRLRRPETPPPPSTRQ CPFCLSPIPLAASRCPQCTSAVEPTAT
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating intracellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the mechanosensitive channel of large conductance (MscL) and what is its primary function in bacteria?

MscL functions as an emergency release valve that opens in response to membrane tension caused by osmotic shock. The channel forms a homopentamer with each subunit containing two transmembrane regions and gates via the bilayer mechanism triggered by hydrophobic mismatch and changes in membrane curvature and/or transbilayer pressure profile . During stationary phase and osmotic shock, MscL expression is upregulated to prevent cell lysis . The channel conductance is notably large at approximately 3.6 nS, which is 1-2 orders of magnitude larger than most eukaryotic channels .

Why are Geobacter species significant in bioelectrochemical research?

Geobacter species are dissimilatory metal-reducing microorganisms discovered in the late 1980s that can transfer electrons from cytoplasmic respiratory oxidation reactions to external electron acceptors including metal-containing minerals and electrodes . As exoelectrogens (microorganisms capable of transferring electrons to electrodes), Geobacter species are extensively used in bioelectrochemical systems (BESs) for various biotechnological applications including bioelectricity generation via microbial fuel cells . Geobacter biofilms grown on electrode surfaces are electrically conductive due to matrix-associated electroactive components such as c-type cytochromes and electrically conductive nanowires .

What are the key differences between Geobacter metallireducens and Geobacter sulfurreducens?

Both species are important metal-reducing bacteria, but they exhibit distinct metabolic capabilities:

CharacteristicG. sulfurreducensG. metallireducens
Hydrogen utilizationCan utilize hydrogen as electron donorCannot oxidize hydrogen
Current density in MECs (0.7V)~160 A/m³110±7 A/m³
H₂ production rates~1.9 m³ H₂/m³/day1.3±0.1 m³ H₂/m³/day
Energy recovery77±2%78±5%
Metabolic versatilityLess versatileGreater versatility for metabolism of organic acids (acetate, propionate, pyruvate)
Genome featuresContains molybdate (ModE) regulonLost the ModE global regulatory protein but retained some ModE-binding sites

Data compiled from .

How should growth conditions be optimized when culturing Geobacter species for MscL expression studies?

When culturing Geobacter species, researchers should consider:

  • Media composition: Use modified fresh water medium (NBAF) for G. sulfurreducens . Note that mineral content can be limiting; Fe is the most limiting metal in standard medium, allowing only ~0.10 g cells/L, with Cu and Zn also approaching limiting concentrations .

  • Scale considerations: When scaling up from laboratory-scale to industrial production, be aware that metabolic states can differ significantly. Research has shown delayed stationary phase during scale-up processes (from 100-ml serum bottles to 5-liter bioreactors) .

  • Monitoring growth: Track optical density at 600 nm along with PC-DFA (Principal Component-Discriminant Function Analysis) to assess metabolic states .

  • Anoxic conditions: Maintain strictly anoxic conditions at 30°C for optimal growth .

  • Inoculum: Use 10% (vol/vol) late-log-phase culture for consistent results .

For MscL expression specifically, consider that MscL expression is naturally upregulated during stationary phase and osmotic shock conditions , which may be leveraged for increased recombinant expression.

What methodologies are most effective for quantifying MscL expression levels in Geobacter species?

Based on studies of MscL in other bacteria, a combination of approaches is recommended:

  • Quantitative fluorescence microscopy using fluorescently tagged MscL proteins to measure expression at the single-cell level, which has revealed that:

    • The mean number of channels per cell is higher than previously estimated

    • There is marked variability in channel numbers from cell to cell

    • Channel numbers change under different environmental conditions

  • Quantitative Western blotting for protein-level quantification as a complementary approach to fluorescence methods .

  • Electrophysiology-based measurements using patch-clamp techniques to assess functional channel expression through conductance measurements .

  • qRT-PCR to measure transcript abundance if investigating transcriptional regulation of mscL genes, similar to approaches used to measure gene expression in Geobacter uraniireducens .

How can researchers effectively design coculture experiments involving recombinant Geobacter expressing MscL?

When designing coculture experiments:

  • Consider partner selection carefully:

    • For methanogenesis studies, Methanosarcina species have been successfully cocultured with Geobacter, resulting in increased methane yield (by 24.1%, achieving 360.2 mL/g-COD) and improved energy efficiency (up to 74.6%) .

    • For bioelectricity generation, cocultures of non-exoelectrogens (like E. coli) with G. sulfurreducens have shown improved system performance due to oxygen consumption by the non-exoelectrogenic species .

  • Implement analytical methods:

    • Use protein quantification (e.g., BCA method) to assess total biomass .

    • Apply real-time PCR with species-specific primers to determine relative abundance of each organism in the coculture .

    • Employ fluorescence in situ hybridization to observe spatial relationships between cocultured species .

    • Use cyclic voltammetry to confirm electrochemical activities of each species .

  • Monitor metabolic interactions:

    • Track electron transfer between species by measuring current densities and gas production

    • Analyze metabolites to understand cross-feeding relationships

How does the oligomeric state of MscL influence its gating characteristics when expressed in Geobacter?

The oligomeric state of MscL significantly affects its gating properties through the energetic cost of lipid bilayer deformations:

  • MscL has been proposed to exist in tetrameric, pentameric, and hexameric states, with the pentameric form being most common . Each state creates distinct hydrophobic mismatches with the surrounding lipid bilayer.

  • These different oligomeric states yield distinct membrane contributions to the gating energy and gating tension . Theoretical models predict that:

    • Different oligomeric states have unique energetic costs for channel opening

    • The symmetry of the oligomeric state affects the shape of the hydrophobic surface and thus the gating characteristics

  • Quantitative predictions from elastic models show that:

    • The hydrophobic shape of MscL is reflected in the energetic cost of lipid bilayer deformations

    • The oligomeric state creates a functional "signature" that can be measured experimentally

When expressing recombinant MscL in Geobacter, researchers should consider how the lipid composition of Geobacter (which has high lipid content at 32±0.5% dry weight/dry weight ) might interact with different oligomeric states of MscL.

What role might MscL play in the electron transfer mechanisms of Geobacter species?

While direct evidence linking MscL to electron transfer in Geobacter is not established in the provided sources, potential connections can be hypothesized based on known mechanisms:

  • Osmotic regulation during electron transfer: MscL could help maintain cellular homeostasis during electron transfer processes, which often involve ion movements across membranes.

  • Potential interface with cytochrome networks: Geobacter species rely heavily on an extensive cytochrome network for electron transfer. G. sulfurreducens cells contain high amounts of iron (2±0.2 μg/g dry weight) , much of which is incorporated into cytochromes. MscL may interact with this network under certain stress conditions.

  • Relationship to membrane potential: Electron transfer processes in Geobacter affect membrane potential, which in turn could influence MscL gating through changes in membrane tension.

  • Biofilm structure considerations: Geobacter forms electrically conductive biofilms, and MscL might contribute to osmotic regulation within these complex structures, particularly during environmental fluctuations.

Further research specifically examining the interplay between MscL and the electron transfer machinery of Geobacter would be valuable for understanding these potential relationships.

How do the functional domains of MscL compare between E. coli and Geobacter species, and what implications might this have for recombinant expression?

Comparing functional domains requires detailed structural analysis:

  • E. coli MscL structural features:

    • The crystal structure of MscL from Mycobacterium tuberculosis (closely related to E. coli MscL) revealed that gating cannot occur solely with a gate placed within the transmembrane domain

    • Molecular models suggest gating is accomplished by N-terminal domains (S1) connected to the transmembrane barrel via flexible linkers

    • Site-directed mutagenesis studies have identified residues that determine the energy of closed-to-open transitions and dwell time in each state

  • Potential Geobacter adaptations:

    • Geobacter membranes may have different physical properties due to their unique lipid composition (32±0.5% dry weight/dry weight)

    • The high iron content in Geobacter cells (2±0.2 μg/g dry weight) might affect the local environment of membrane proteins

    • The extensive electron transfer apparatus in Geobacter could interact with recombinant MscL in ways not seen in E. coli

  • Expression considerations:

    • Codon optimization would be essential for efficient translation in Geobacter

    • The different membrane composition might affect protein folding and insertion

    • The energetic state of Geobacter cells (which have high C:O and H:O ratios of approximately 1.7:1 and 0.25:1, indicating a more reduced cell composition ) could influence protein expression and function

How might the porin-cytochrome gene clusters in Geobacter interact with recombinant MscL?

This is a complex question involving potential interactions between different membrane protein systems:

  • Porin-cytochrome (pcc) gene clusters in Geobacter metallireducens:

    • Three clusters have been identified: Gmet0825-0828, Gmet0908-0910, and Gmet0911-0913

    • These clusters play essential, distinct, overlapping, and compensatory roles in extracellular electron transfer (EET)

    • Deletion studies suggest robustness of the system, as G. metallireducens can still mediate EET when two of its three pcc gene clusters are inactivated

  • Potential interactions with recombinant MscL:

    • Membrane space competition: Both systems require membrane real estate, potentially leading to crowding effects

    • Structural interactions: The membrane deformations induced by MscL gating could affect the conformation and function of porin-cytochrome complexes

    • Regulatory crosstalk: Stress responses that upregulate MscL might also affect expression of porin-cytochrome complexes

  • Experimental approaches to study interactions:

    • Co-immunoprecipitation to detect physical interactions

    • Dual-color fluorescence microscopy to observe co-localization

    • Electrophysiology combined with metal reduction assays to assess functional interactions

    • Gene expression analysis to identify regulatory relationships

What are the challenges and strategies for engineering Geobacter biofilms with modified MscL expression for enhanced bioelectrochemical performance?

Engineering biofilms with modified MscL expression presents several challenges and opportunities:

  • Biofilm-specific challenges:

    • Geobacter biofilms are electrically conductive, with matrix-associated electroactive components such as c-type cytochromes and electrically conductive nanowires

    • Biofilm development and matrix composition could be affected by modified MscL expression

    • Heterogeneity within biofilms may lead to variable MscL expression levels

  • Regulatory considerations:

    • Quorum sensing plays a role in Geobacter biofilm formation, with AHL-type signals enhancing the formation and electrochemical activity of biofilms

    • AHL addition has been shown to increase biomass, cell viability, and EPS abundance in G. soli GSS01 biofilms grown on electrodes

    • MscL expression may need to be coordinated with these regulatory systems

  • Engineering strategies:

    • Develop inducible expression systems responsive to electrochemical conditions

    • Create MscL variants with altered gating properties through site-directed mutagenesis

    • Use synthetic biology approaches to link MscL expression to biofilm development stages

    • Co-express MscL with components that enhance electron transfer, such as additional cytochromes

  • Performance measurement:

    • Monitor current density, which can reach ~160 A/m³ in G. sulfurreducens systems

    • Measure energy recovery, which can be as high as 77±2% in G. sulfurreducens and 78±5% in G. metallireducens

    • Assess biofilm structure and conductivity using microscopy and electrochemical techniques

What factors might contribute to low expression levels of recombinant MscL in Geobacter species?

Several factors could limit expression of recombinant MscL:

  • Metabolic constraints:

    • Geobacter has unique metabolic requirements with high iron content (2±0.2 μg/g dry weight) and lipid composition (32±0.5% dry weight/dry weight)

    • Medium limitations, particularly iron (which allows only ~0.10 g cells/L), copper, and zinc could restrict growth and protein expression

  • Expression system issues:

    • Inappropriate promoter selection for anaerobic conditions

    • Codon usage bias not optimized for Geobacter

    • Inefficient translation or protein folding in Geobacter's membrane environment

  • Protein toxicity:

    • Overexpression of membrane channels can disrupt membrane integrity

    • MscL gating could cause undesirable ion fluxes affecting cell viability

  • Experimental detection limitations:

    • Challenges in protein extraction from Geobacter's complex membrane system

    • Interference from high iron content in analytical methods

  • Troubleshooting strategies:

    • Test different promoter systems, particularly those native to Geobacter

    • Optimize codons for Geobacter-specific usage

    • Use fusion tags that enhance stability without compromising function

    • Implement inducible expression systems with fine control

    • Enrich culture media with limiting minerals identified through elemental analysis

How can researchers address variability in MscL functionality when expressed in different Geobacter strains?

Addressing strain-specific variability requires systematic approaches:

  • Strain-specific characterization:

    • Compare genomic differences between strains, particularly in membrane composition genes

    • Analyze native mechanosensitive channel expression and regulation in each strain

    • Assess membrane physical properties among strains

  • Standardized functional assays:

    • Develop osmotic shock survival assays calibrated for Geobacter

    • Implement patch-clamp protocols adapted for different Geobacter strains

    • Use fluorescence-based methods to track ion or solute movement through MscL channels

  • Expression normalization strategies:

    • Select promoters with consistent activity across strains

    • Use strain-specific ribosome binding sites to achieve comparable translation efficiency

    • Implement chromosomal integration at conserved loci rather than plasmid-based expression

  • Data analysis approaches:

    • Apply Principal Component Analysis to identify key variables driving strain differences

    • Develop predictive models relating strain characteristics to MscL functionality

    • Use single-cell analysis techniques to characterize cell-to-cell variability within strains

Single-cell census studies of MscL have revealed that even within isogenic populations, channel numbers can vary significantly from cell to cell , suggesting that strain-level differences may be compounded by intrinsic biological variability.

What novel applications might emerge from engineering Geobacter with modified MscL for environmental remediation?

Engineering Geobacter with modified MscL could open new applications in bioremediation:

  • Enhanced uranium bioremediation:

    • Geobacter species are used for in situ uranium bioremediation through dissimilatory metal reduction

    • Modified MscL could improve osmoregulation during environmental fluctuations, potentially increasing cell survival and metal reduction capacity

    • Expression of rpsC correlates with the actual rate that Geobacter species are metabolizing and growing during in situ uranium bioremediation

  • Improved heavy metal tolerance:

    • Modified MscL could facilitate adaptation to environments with varying ionic strengths

    • Engineering MscL to respond to specific metal-induced stresses might enhance survival in contaminated sites

  • Integration with methane production:

    • Cocultures of Geobacter with methanogens have increased methane yields by 24.1%, achieving 360.2 mL/g-COD

    • MscL-modified Geobacter might better withstand osmotic fluctuations in these systems, improving long-term performance

    • Carbon dioxide content in gas generated from AD reactors with Geobacter was only half of that generated without Geobacter

  • Climate change mitigation:

    • Enhanced methane production coupled with carbon sequestration

    • Improved electron transfer to electrodes for renewable energy generation from waste

How might single-cell technologies advance our understanding of MscL function in Geobacter species?

Single-cell technologies offer powerful approaches to study MscL in Geobacter:

  • Single-cell genomics and transcriptomics:

    • Reveal heterogeneity in mscL expression within Geobacter populations

    • Identify correlations between expression levels and other cellular characteristics

    • Map regulatory networks controlling mscL expression at the single-cell level

  • Advanced microscopy techniques:

    • Super-resolution microscopy could visualize MscL distribution and clustering in the membrane

    • Time-resolved microscopy might capture channel gating events in living cells

    • FRET-based approaches could detect conformational changes during gating

  • Single-cell electrophysiology:

    • Patch-clamp studies of individual Geobacter cells expressing MscL

    • Correlation of channel activity with single-cell electron transfer capabilities

    • Investigation of how membrane potential fluctuations during electron transfer affect MscL gating

  • Second harmonic scattering (SHS) techniques:

    • Time-resolved SHS has been used to experimentally observe the state (open versus closed) of bacterial MS channels in living bacterial suspensions

    • This technique could be adapted to study MscL in Geobacter, potentially revealing unique gating characteristics

  • Microfluidics platforms:

    • Create controlled microenvironments for single-cell studies

    • Apply precise osmotic challenges while monitoring cellular responses

    • Integrate with electrical measurements to correlate MscL activity with electron transfer

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.