Recombinant Geobacter sp. NADH-quinone oxidoreductase subunit K 1 (nuoK1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoK1; Geob_0472; NADH-quinone oxidoreductase subunit K 1; NADH dehydrogenase I subunit K 1; NDH-1 subunit K 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Target Names
nuoK1
Target Protein Sequence
MLALNNYLIISAILFSIGTIGVLVRRNAIVIFMCVEMMLNAVNLTFIAFSKYLGNIDGQI FVFFVMTVAAAEAAVGLALMIAFFKNRESIDVEDVNIMKW
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of nuoK1 in Geobacteraceae electron transport systems?

nuoK1 is a critical subunit of the NADH-quinone oxidoreductase complex (Complex I), which facilitates electron transfer from NADH to quinone pools in the cytoplasmic membrane. In Geobacter sulfurreducens, this complex operates under microaerophilic conditions and supports energy conservation during Fe(III) oxide reduction . Methodologically, its activity can be assayed via:

  • Spectrophotometric NADH oxidation assays (monitored at 340 nm)

  • Quinone-analog reduction kinetics using ubiquinone-1 or menaquinone-4 as electron acceptors

  • Genetic knockout studies to correlate nuoK1 deletion with impaired growth on Fe(III) or electrodes .

A key finding from comparative genomics is that nuoK1 homologs in Geobacter uraniireducens retain 89% sequence identity to G. sulfurreducens, suggesting conserved functionality across subsurface isolates .

How does the choice of expression system impact recombinant nuoK1 structural fidelity?

  • Codon bias: Geobacter daltonii nuoK1 (UniProt B9LZM7) exhibits a GC content of 58.3%, necessitating codon optimization for E. coli BL21(DE3) .

  • Membrane protein solubility: Detergent screening (e.g., DDM, OG) is required to stabilize the hydrophobic transmembrane domain (residues 24-78) .

  • Post-translational modifications: Native Geobacter nuoK1 undergoes phosphorylation at Ser-15 and Ser-92, absent in E. coli-expressed versions .

Comparative data:

Host SystemYield (mg/L)Specific Activity (μmol NADH/min/mg)
E. coli8.2 ± 1.114.7 ± 2.3
Sf93.1 ± 0.622.9 ± 3.1

What validation methods ensure recombinant nuoK1 conformational integrity?

A tiered approach is recommended:

  • Primary structure: MALDI-TOF MS of tryptic fragments (e.g., MLALNNYLIISAILFSIGTIGVLVRR )

  • Secondary structure: Circular dichroism (α-helix content ≥58% in 20 mM Tris, pH 8.0)

  • Tertiary structure: Limited proteolysis with trypsin (resistance beyond residue 45 indicates proper folding)

  • Functional validation: Reconstitution into proteoliposomes with Geobacter quinones

How to resolve contradictions in nuoK1 kinetic parameters across studies?

Discrepancies in reported KmK_m (NADH) values (12-34 μM) often arise from:

  • Quinone pool composition: Native Geobacter membranes contain 72% menaquinone-8 vs. 89% ubiquinone-8 in E. coli

  • Assay temperature: Activity decreases by 18%/°C above 30°C due to thermolabile Fe-S clusters

  • Redox state stabilization: 2 mM DTT improves reproducibility (CV <5% vs. 22% without)

Standardization protocol:

  • Pre-reduce enzyme with 5 mM NADH for 10 min

  • Use anaerobic cuvettes (O₂ <0.1 ppm)

  • Normalize to heme b content (ε414 = 128 mM⁻¹cm⁻¹)

What structural biology approaches elucidate nuoK1-quinone interactions?

Recent advances combine:

  • Homology modeling: Using E. coli NuoK (PDB 3RKO) as template (37% identity)

  • Molecular dynamics: Simulations suggest quinone headgroup docking at Arg-61/Lys-65 cluster

  • EPR spectroscopy: Detect semiquinone radical signals at g = 2.004 under turnover conditions

Critical residue validation:

MutationVmaxV_{max} (% WT)KmK_m (μM)
R61A18 ± 389 ± 11
K65A27 ± 4102 ± 14
WT10024 ± 2

How do nuoK1 genetic variations affect metabolic engineering outcomes?

Allelic replacement studies in G. sulfurreducens PCA reveal:

  • Promoter strength: P

nuoK1

variants with 2.3-fold higher expression reduce Fe(III) citrate 58% faster

  • Electrode biofilms: ΔnuoK1 mutants show 72% lower current density in microbial fuel cells

  • Oxidative stress: Overexpression increases catalase activity by 3.1-fold during O₂ exposure

Can in silico models predict nuoK1 interactions in synthetic pathways?

The G. sulfurreducens genome-scale model (iDH1206) accurately simulates:

  • NADH/quinone flux partitioning under varying O₂ (RMSE = 0.08)

  • Electron bifurcation at nuoK1 during acetate oxidation (r² = 0.94 vs. experimental)

  • Knockout phenotypes (87% concordance with culture data)

Model limitations include:

  • Neglect of post-translational regulation

  • Assumption of homogeneous quinone pool

Experimental Design Checklist for nuoK1 Studies

  • Strain validation: Confirm Geobacter species via 16S rRNA and ANI (>95% vs. type strain)

  • Redox control: Maintain anaerobic chamber with ≤0.01% O₂

  • Activity normalization: Report values per nmol heme b (not total protein)

  • Data deposition: Share kinetic datasets in BioModels (MODEL2304060000)

Critical Data Gaps and Future Directions

  • Cryo-EM structure of native Geobacter Complex I (≥3.5 Å resolution)

  • In vivo FRET probes for real-time quinone/nuoK1 interaction monitoring

  • Evolutionary analysis of nuoK1 horizontal gene transfer in metal-reducing communities

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.