Recombinant Geobacter sulfurreducens Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lnt; GSU2281; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-477
Protein Length
full length protein
Species
Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Target Names
lnt
Target Protein Sequence
MPGFNAVPRRDYVMAALSGVLLALSFPKPGFSILAWVALVPLLLACGRKAPAVAFRLGFT AGLVAYAGILYWINIAVVTYGRLHWSVSIVIFLMLAGYLALYPAATAYVVRRGEDRGISA LLAFPVVWVGLEYIRSFLLTGFPWASLGYSQYRTLPLIQIADLTGVYGLSFLIALSNVVL YRIIRGFAARERAPYPVKSAAILVLLLVATLAYGFNRLHRPEAGAPFSVALIQGNIDQSV KWDPAFQEATVAVYERLSRKACSTGPADLVVWPESAVPFYLQNEEKYASRIRNLTRELRS CTVVGSPAFERDGETIRYLNSAFLLSPWGDVVGRSDKIHLVPFGEYVPMAKFLPFVNKIV AGIGDFSPGARIASLETGKGAIGVLVCFEGIFPELARGYVRAGSRVLVNITNDAWYKRSS APYQHLSMTVFRAVENRVPLVRAANTGITAIIDSKGHILRMTNLFEVWRPRFSWTRK
Uniprot No.

Target Background

Function
Catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, representing the final step in lipoprotein maturation.
Database Links

STRING: 243231.GSU2281

Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase (lnt) and what role does it play in Geobacter sulfurreducens?

Apolipoprotein N-acyltransferase (lnt) is an enzyme responsible for the final step in bacterial lipoprotein processing, specifically adding a third acyl chain to the N-terminal cysteine of lipoproteins. In Geobacter sulfurreducens, a metal-reducing bacterium that oxidizes organic compounds using Fe(III) oxide as the terminal electron acceptor, lipoproteins are critical for cell envelope integrity and various cellular processes . Similar to what has been observed in Bacteroides species, the lnt enzyme likely catalyzes the conversion of diacylated lipoproteins to triacylated forms . This modification is essential for proper localization and function of outer membrane lipoproteins, which may be involved in G. sulfurreducens' unique metal reduction capabilities.

What expression systems have proven most effective for producing recombinant G. sulfurreducens proteins?

E. coli expression systems have been successfully used to produce recombinant G. sulfurreducens proteins, as demonstrated with cytochrome c7. When expressing G. sulfurreducens cytochrome c7, co-expression with the cytochrome c maturation gene cluster (ccmABCDEFGH) on a separate plasmid was critical for proper protein folding and heme incorporation . For membrane proteins like lnt, similar considerations would apply, with potential modifications to expression constructs. Notably, the absence of an N-terminal His-tag resulted in better yield and proper folding of recombinant cytochrome c7 (up to 6 mg/l of aerobic culture), suggesting that N-terminal modifications may interfere with protein maturation in G. sulfurreducens proteins .

What strategies can overcome the challenges of expressing membrane-bound recombinant G. sulfurreducens lnt while maintaining its catalytic activity?

Expressing membrane proteins like lnt presents several challenges that require specialized approaches. Based on experiences with other G. sulfurreducens proteins, researchers should consider:

  • Membrane targeting and topology: Using a dual-plasmid system where one plasmid contains the lnt gene and another provides necessary chaperones or folding factors.

  • Expression conditions optimization: Given that the untagged version of cytochrome c7 provided better yield than the His-tagged version , researchers should test multiple constructs with varying tag positions or no tags.

  • Detergent selection for solubilization: A panel of mild detergents should be screened to find optimal conditions for extracting functional lnt while preserving its native conformation and activity.

  • Activity verification: Developing assays that can measure the N-acyltransferase activity directly from membrane preparations or after purification in detergent micelles.

Importantly, researchers should evaluate whether lipid composition affects enzyme activity, potentially supplementing expression media with specific lipids found in G. sulfurreducens membranes.

How does the metabolic network of G. sulfurreducens influence the expression and function of recombinant lnt?

The metabolic network of G. sulfurreducens has been extensively characterized through constraint-based modeling approaches . This network analysis reveals several factors that may impact recombinant lnt expression:

  • Energy limitations: G. sulfurreducens relies on electrogenic electron transport for ATP production and cannot generate ATP via substrate-level phosphorylation from acetate . This energy limitation may affect protein synthesis capacity when expressing recombinant proteins.

  • Proton translocation dynamics: The unique proton handling in G. sulfurreducens, especially differences between cytoplasmic and extracellular compartments , may influence membrane protein folding and insertion.

  • TCA cycle operation: During growth with external electron acceptors, G. sulfurreducens operates an "open loop" TCA cycle , which may affect the availability of metabolic precursors for protein synthesis.

A detailed understanding of these metabolic constraints could inform optimization strategies for enhancing recombinant lnt expression while maintaining its functional properties.

What are the potential implications of lnt dysfunction on G. sulfurreducens' extracellular electron transfer capabilities?

Lipoproteins modified by lnt likely play critical roles in the extracellular electron transfer pathways of G. sulfurreducens. Based on research with other bacterial systems and G. sulfurreducens' known properties:

  • Outer membrane integrity: Improperly processed lipoproteins due to lnt dysfunction could compromise membrane integrity, potentially disrupting the localization or function of cytochromes involved in electron transfer.

  • Metal interaction: G. sulfurreducens can interact with metals like iron and cobalt , and these interactions may involve outer membrane proteins that require proper lipid modification by lnt.

  • Stress response: The ability of G. sulfurreducens to form protective shields against toxic metals might involve lipoproteins that depend on lnt for proper processing and localization.

Experimental approaches to investigate these relationships could include creating conditional lnt mutants and analyzing their electron transfer capabilities under various conditions.

What purification methods are most suitable for isolating functional recombinant G. sulfurreducens lnt?

Based on experiences with other G. sulfurreducens proteins and membrane-bound enzymes, researchers should consider:

Purification MethodAdvantagesConsiderationsExpected Yield
Detergent extraction followed by affinity chromatographyEfficient single-step purificationMay require C-terminal tag to avoid interference with function1-3 mg/L culture
Membrane fractionation followed by ion exchange chromatographyPreserves native-like lipid environmentMore labor-intensive, potentially higher activity0.5-1.5 mg/L culture
Amphipol or nanodisc reconstitution after purificationMaintains stability in detergent-free environmentRequires optimization of reconstitution conditions70-80% recovery from detergent-purified protein

When purifying lnt, it's critical to monitor enzyme activity throughout the process, as detergent-solubilized membrane proteins can lose activity despite appearing structurally intact .

How can researchers develop reliable activity assays for recombinant G. sulfurreducens lnt?

Developing robust assays for lnt activity requires addressing several technical challenges:

  • Substrate preparation: Synthetic diacylated peptide substrates corresponding to G. sulfurreducens lipoprotein signal sequences can be used to measure N-acyltransferase activity.

  • Acyl donor selection: Phospholipids extracted from G. sulfurreducens membranes would provide native acyl donors, though defined phospholipids can also be tested to determine specificity.

  • Detection methods: Mass spectrometry-based assays can detect the conversion of diacylated to triacylated peptides, while HPLC-based methods can be used for quantitative kinetic analyses.

  • In vivo complementation: Similar to the approach used with Bacteroides Lnb , heterologous expression of G. sulfurreducens lnt in E. coli lnt-deficient strains could provide a functional complementation assay.

A combination of these approaches would provide comprehensive insights into the enzymatic properties of recombinant G. sulfurreducens lnt.

How can researchers identify the gene encoding lnt in G. sulfurreducens and confirm its function?

Identifying and confirming the G. sulfurreducens lnt gene requires a multi-faceted approach:

  • Bioinformatic analysis: Using sequence similarity to known bacterial lnt genes or structural predictions to identify candidates in the G. sulfurreducens genome.

  • Gene cloning and heterologous expression: Similar to approaches used for cytochrome c7 , the putative lnt gene can be cloned and expressed in E. coli.

  • Complementation studies: Testing whether the cloned gene can rescue growth defects in conditional E. coli lnt mutants, similar to the rescue observed with Bacteroides Lnb .

  • Targeted gene disruption: Creating knockout or conditional mutants in G. sulfurreducens to observe phenotypic effects on growth, membrane integrity, and electron transfer capabilities.

  • Lipidomic analysis: Comparing the lipoprotein profiles of wild-type and mutant strains to confirm changes in lipidation patterns.

These approaches would provide multiple lines of evidence for gene identification and functional confirmation.

What experimental designs can detect the in vivo effects of lnt mutations on G. sulfurreducens growth and metabolism?

To assess the physiological importance of lnt in G. sulfurreducens, researchers can implement:

  • Growth rate analysis: Using methods similar to those developed for measuring in situ growth rates of Geobacter species , researchers can quantify how lnt mutations affect growth under various conditions.

  • Metabolic flux analysis: Leveraging existing metabolic models of G. sulfurreducens , researchers can predict and measure changes in metabolic fluxes resulting from lnt dysfunction.

  • Respiratory capacity measurements: Since G. sulfurreducens relies on electron transfer to external acceptors like Fe(III) , measuring reduction rates with various electron acceptors would reveal functional impacts of lnt mutations.

  • Stress response evaluation: Testing how lnt mutations affect the cell's ability to handle environmental stressors, particularly toxic metals that G. sulfurreducens can normally shield against .

  • Membrane integrity assays: Examining changes in membrane permeability, protein composition, and lipid distribution in lnt mutants compared to wild-type strains.

The experimental design should incorporate controls that distinguish direct effects of lnt dysfunction from secondary metabolic adaptations.

How does G. sulfurreducens lnt differ from homologous enzymes in other bacteria, and what are the implications for its function?

Comparative analysis of lnt across bacterial species reveals important evolutionary patterns:

  • Protein family classification: While classical Gram-negative bacteria like E. coli possess Lnt enzymes belonging to the CN hydrolase family, Bacteroides species utilize a distinct enzyme (Lnb) for N-acylation of lipoproteins . Determining which family G. sulfurreducens lnt belongs to would provide insights into its evolutionary history and mechanistic properties.

  • Substrate specificity: Differences in the diacylated lipoprotein substrates recognized by lnt homologs may reflect adaptations to specific membrane environments or functional requirements in different bacteria.

  • Cellular localization: The subcellular localization of lnt may differ between bacterial species, potentially reflecting differences in cell envelope architecture or lipoprotein trafficking pathways.

  • Environmental adaptations: As a metal-reducing bacterium, G. sulfurreducens may have evolved unique features in its lnt enzyme to accommodate the specific demands of its ecological niche, including potential interactions with metal ions .

Phylogenetic analysis combined with structural modeling could help predict functional differences between G. sulfurreducens lnt and better-characterized homologs.

What role might lnt play in G. sulfurreducens' unique ability to reduce metals and conduct electricity?

G. sulfurreducens' distinctive capacity for extracellular electron transfer may be linked to lnt function through several mechanisms:

  • Cytochrome localization: Proper localization of outer membrane cytochromes critical for electron transfer may depend on lnt-mediated lipoprotein processing.

  • Membrane organization: The organization of electron transfer components in the membrane, which affects electron conductivity, may be influenced by correctly processed lipoproteins.

  • Metal interaction interfaces: G. sulfurreducens can form protective shields against toxic metals and extract metals like cobalt from environmental sources . These capabilities may involve lipoproteins that require lnt-mediated modification.

  • Biofilm formation: G. sulfurreducens forms electroactive biofilms, and the structural components of these biofilms may include lipoproteins processed by lnt.

Investigating correlations between lnt activity and electron transfer efficiency could reveal previously unrecognized connections between protein lipidation and electrical conductivity in bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.