Recombinant Geobacter sulfurreducens ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

The recombinant atpB protein is produced in Escherichia coli expression systems .

ParameterDetails
Expression HostE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE verified)
StorageTris-based buffer with 50% glycerol; store at -20°C or -80°C
AvoidanceRepeated freeze-thaw cycles to prevent degradation

Functional Role in G. sulfurreducens Metabolism

ATP synthase in G. sulfurreducens is essential for energy metabolism, particularly during extracellular electron transfer (EET) to metals or electrodes . Subunit a directly participates in proton translocation, enabling ATP synthesis under anaerobic conditions .

Key Metabolic Insights

  • Electron Transport Coupling: ATP production in G. sulfurreducens is strictly dependent on electrogenic EET, with subunit a enabling proton motive force utilization .

  • Redundancy in Pathways: Computational models identify ATP synthase as non-redundant, highlighting its indispensable role in energy conservation .

Bioelectricity Production

Engineered G. sulfurreducens strains overexpressing ATP synthase subunits exhibit enhanced respiration rates, improving microbial fuel cell (MFC) performance . For example:

  • ATP Drain Strategy: Inducing heterologous ATPase expression (e.g., E. coli F1 subunits) increases electron flux by 3x, boosting Fe(III) reduction .

Challenges and Future Directions

  • Stability Issues: Recombinant atpB requires glycerol buffers for long-term storage .

  • Heterologous Expression: Codon optimization improves E. coli yields but may alter native protein interactions .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
atpB; GSU0334; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Target Names
atpB
Target Protein Sequence
MVHPLLFLQFFRKLLEPLHISEAGADAIAYTWLIIVCLLIVSLIATKALKAVPTGMQNFM EVVIGGIENMVEETMGEKGKPYFPLIATLALFVLVSNLIGLIPGFFPPTANLNTTAACAV IVFLSTHIVGIKKHGFHYLQHFMGPIWWLAPLMFFIEIIGHLSRPLSLSLRLFGNMNGHE LVLMIFFALAPFLVPLPMMLMGVLVSFIQAFVFMLLAMIYIQGSLEEAH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: gsu:GSU0334

STRING: 243231.GSU0334

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of ATP synthase in Geobacter sulfurreducens metabolism?

ATP synthase in Geobacter sulfurreducens plays a crucial role in energy generation through oxidative phosphorylation. This enzyme complex catalyzes the synthesis of ATP from ADP and inorganic phosphate using the energy of an electrochemical ion gradient. In Geobacter species, ATP synthase is particularly important because these bacteria are known for their ability to transfer electrons to extracellular electron acceptors such as metal oxides and electrodes, which is coupled to ATP synthesis . The F1F0-ATP synthase complex in G. sulfurreducens has been identified as essential for growth and energy conservation, especially when the organism is metabolizing acetate as an electron donor and fumarate, Fe(III), or electrodes as electron acceptors .

How is the ATP synthase complex organized in Geobacter sulfurreducens?

The ATP synthase in G. sulfurreducens follows the typical F1F0-ATP synthase organization found in prokaryotes. It is composed of two main parts:

  • The membrane-embedded F0 sector, which includes subunits a (encoded by atpB), b, b', and a ring of c subunits

  • The water-soluble F1 sector, containing subunits α3, β3, γ, δ, and ε

The F0 sector is responsible for ion translocation across the membrane, while the F1 sector contains the catalytic sites for ATP synthesis or hydrolysis. The atpB gene (GSU0334) specifically encodes the a subunit of the F0 sector, which forms part of the ion channel and is critical for the rotary mechanism of the enzyme .

How does the structure of atpB in Geobacter sulfurreducens compare to other bacterial species?

The ATP synthase subunit a (atpB) in G. sulfurreducens is a 229-amino acid protein with multiple transmembrane domains. Its structure includes:

  • Highly hydrophobic transmembrane segments that form the ion channel

  • Conserved residues essential for ion translocation

  • A molecular weight of approximately 25 kDa

When compared to other bacterial species, the G. sulfurreducens atpB shares conserved functional domains typical of F-type ATP synthases, but displays sequence variations that may reflect adaptation to the unique electron transfer mechanisms of Geobacter species. Unlike some mycobacterial ATP synthases that have extended C-terminal regions in their α subunits which regulate ATP hydrolysis, the G. sulfurreducens atpB seems to lack such regulatory extensions .

What expression systems are most effective for producing recombinant G. sulfurreducens atpB?

Based on available research data, E. coli serves as the most effective heterologous expression system for recombinant G. sulfurreducens atpB. Current protocols typically employ:

  • Expression vectors with strong promoters (T7 or tac)

  • E. coli strains optimized for membrane protein expression (C41(DE3), C43(DE3), or BL21(DE3))

  • N-terminal or C-terminal His-tag for purification purposes

What challenges are commonly encountered during recombinant atpB expression and how can they be overcome?

Several challenges frequently arise when expressing recombinant atpB:

ChallengePotential SolutionRationale
Protein toxicity to host cellsUse tightly regulated expression systems; induction at lower temperatures (16-20°C)Reduces basal expression and slows production rate to allow proper folding
Poor membrane integrationOptimize detergent selection for extraction; use specialized E. coli strains for membrane proteinsEnsures proper folding and integration of hydrophobic segments
Low yieldOptimize codon usage for E. coli; use rich media with glycerol supplementationEnhances translation efficiency and provides energy for protein production
Improper foldingExpress with chaperone co-expression plasmids; optimize induction conditionsAssists with correct folding of complex membrane proteins
AggregationAdd mild solubilizing agents during purification; optimize buffer conditionsPrevents protein aggregation during extraction and purification

Studies on other membrane proteins from G. sulfurreducens suggest that expression at lower temperatures (18-25°C) after induction and the use of specialized membrane protein expression systems can significantly improve yields and functionality .

What is the optimal purification strategy for recombinant G. sulfurreducens atpB?

The optimal purification strategy for recombinant G. sulfurreducens atpB typically involves:

  • Cell lysis: French press or sonication in buffer containing protease inhibitors

  • Membrane fraction isolation: Ultracentrifugation (100,000 × g for 1 hour)

  • Detergent solubilization: Typically using mild detergents such as n-Dodecyl β-D-maltoside (DDM) or digitonin

  • Affinity chromatography: Ni-NTA or TALON resin for His-tagged protein

  • Buffer exchange: To remove imidazole and reduce detergent concentration

  • Storage: In Tris/PBS-based buffer containing 6% trehalose at pH 8.0, with aliquoting and storage at -20°C or -80°C to avoid repeated freeze-thaw cycles

For analytical applications, further purification via gel filtration or ion exchange chromatography may be necessary to achieve higher purity. Reconstitution into liposomes might be required for functional studies.

How can researchers assess the proper folding and functionality of recombinant atpB?

Proper folding and functionality of recombinant atpB can be assessed through multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure composition

    • Limited proteolysis to evaluate folding quality

    • Size exclusion chromatography to detect aggregation

  • Functional assays:

    • Reconstitution into liposomes and measurement of proton/sodium translocation

    • ATP synthesis activity when co-reconstituted with other ATP synthase subunits

    • Protein-protein interaction studies with other ATP synthase subunits

  • Incorporation into ATP synthase complex:

    • Co-expression with other ATP synthase subunits and isolation of the complex

    • Complementation assays in ATP synthase-deficient bacterial strains

    • Analysis of ATP synthesis/hydrolysis activities in reconstituted systems

For meaningful functional assessment, researchers should consider that atpB functions as part of the larger ATP synthase complex and its activity depends on proper integration with other subunits .

What methods can be used to study the ion translocation function of recombinant atpB?

Several specialized techniques can be employed to study the ion translocation function of recombinant atpB:

  • Proteoliposome-based assays:

    • Reconstitution of atpB with other F0 subunits into liposomes

    • Measurement of pH changes using pH-sensitive fluorescent dyes (ACMA or pyranine)

    • Determination of membrane potential changes using potential-sensitive dyes (oxonol V)

  • Patch-clamp electrophysiology:

    • Direct measurement of ion conductance when reconstituted into planar lipid bilayers

    • Characterization of ion selectivity and gating properties

  • Isotope flux assays:

    • Tracking movement of radioactive ions (22Na+ or tritiated H+) across membranes

    • Quantification of ion transport rates under different conditions

  • Site-directed mutagenesis approaches:

    • Systematic mutation of conserved residues predicted to participate in ion translocation

    • Functional characterization of mutants to map the ion translocation pathway

These methods can provide insights into how atpB contributes to the proton/sodium translocation mechanism essential for ATP synthesis in G. sulfurreducens .

How does the ATP synthase activity relate to electron transfer in G. sulfurreducens?

The ATP synthase activity in G. sulfurreducens is intimately linked to its electron transfer mechanisms through several interconnected processes:

  • Electron donor oxidation: When G. sulfurreducens oxidizes acetate or other electron donors, electrons enter the respiratory chain and are transferred to terminal electron acceptors (Fe(III), fumarate, or electrodes) .

  • Proton motive force generation: This electron transfer is coupled to proton translocation across the inner membrane, generating a proton motive force.

  • ATP synthesis coupling: The ATP synthase utilizes this proton motive force to drive ATP synthesis through the rotary mechanism involving atpB and other subunits.

Experimental evidence shows that:

  • ATP synthesis rates are directly correlated with the rates of Fe(III) reduction or electron transfer to electrodes .

  • Modulating ATP synthesis affects extracellular electron transfer rates and vice versa .

  • Artificially increasing ATP demand through expression of uncoupled ATP hydrolysis activity increases respiration rates and electron transfer .

  • Different electron donor/acceptor ratios affect the metabolic patterns and energy conservation efficiency in G. sulfurreducens .

This interdependence makes ATP synthase a critical control point for optimizing G. sulfurreducens-based biotechnological applications such as microbial fuel cells and bioremediation processes.

How is the expression of atpB regulated in G. sulfurreducens under different growth conditions?

The expression of atpB in G. sulfurreducens is subject to sophisticated regulatory mechanisms that respond to different growth conditions:

  • Electron donor/acceptor regulation:

    • When growing with hydrogen as the electron donor, atpB expression appears to be regulated differently compared to growth with acetate .

    • Transcript levels of ATP synthase genes (including atpB) correlate with the rates of Fe(III) reduction and electron transfer to electrodes .

  • Transcriptional regulation:

    • HgtR, a global transcription factor, has been identified as a regulator that affects atpB expression. HgtR represses several genes involved in central metabolism and energy generation, including ATP synthase subunits .

    • Under Pd(II)-reducing conditions, HgtR is upregulated, leading to decreased expression of ATP synthase subunits including atpB, suggesting metabolic adaptation to different electron acceptors .

  • Metabolic state influence:

    • The donor/acceptor ratio significantly affects the metabolic pattern and potentially the expression of energy-generating systems like ATP synthase .

    • During metal reduction (such as Pd(II)), significant changes in energy metabolism genes, including those related to ATP synthesis, have been observed through transcriptome analysis .

These regulatory mechanisms allow G. sulfurreducens to optimize its energy generation based on available electron donors and acceptors, which is critical for its ecological role and biotechnological applications.

What is the relationship between atpB function and the citrate synthase pathway in G. sulfurreducens?

The function of atpB (ATP synthase subunit a) and the citrate synthase pathway in G. sulfurreducens are interrelated through central energy metabolism:

  • Metabolic coupling:

    • Citrate synthase (encoded by gltA) is a key enzyme in the TCA cycle that is important for organic acid oxidation, particularly acetate, which is the primary electron donor for G. sulfurreducens .

    • ATP synthesis via atpB-containing ATP synthase depends on the proton gradient generated during electron transport initiated by organic acid oxidation through the TCA cycle.

  • Co-regulation:

    • Both ATP synthase genes (including atpB) and gltA are regulated by HgtR, a global transcriptional regulator .

    • Under certain conditions (e.g., growth with hydrogen), HgtR represses both gltA and ATP synthase genes, indicating coordinated control of carbon metabolism and energy generation .

  • Metabolic flux relationships:

    • Experimental evidence shows that citrate synthase activity directly correlates with the rates of Fe(III) reduction in chemostats or electron transfer to electrodes in microbial fuel cells .

    • Manipulating ATP demand (which involves ATP synthase function) affects the flux through central metabolic pathways, including the TCA cycle where citrate synthase operates .

This relationship highlights the integrated nature of energy metabolism in G. sulfurreducens, where carbon oxidation, electron transfer, and ATP synthesis must be coordinated for efficient energy conservation.

How can recombinant atpB contribute to understanding the bioenergetics of extracellular electron transfer in Geobacter species?

Recombinant atpB can serve as a valuable tool for elucidating the bioenergetics of extracellular electron transfer in Geobacter species through several experimental approaches:

  • Structure-function studies:

    • Site-directed mutagenesis of conserved residues in atpB followed by functional assays can reveal how specific amino acids contribute to proton translocation and ATP synthesis.

    • Comparing wild-type and mutant atpB performance under different electron transfer conditions can identify bioenergetic bottlenecks.

  • Reconstitution experiments:

    • Incorporation of purified recombinant atpB into liposomes with other ATP synthase components allows measurement of ATP synthesis driven by artificial proton gradients.

    • These systems can be coupled with electrochemical cells to simulate the electron transfer processes occurring in Geobacter biofilms.

  • Thermodynamic analyses:

    • Using recombinant atpB in reconstituted systems enables precise measurement of the minimum proton motive force required for ATP synthesis.

    • This information is crucial for understanding how Geobacter species can survive and generate ATP when using electron acceptors with different redox potentials .

  • Comparative studies:

    • Recombinant atpB from different Geobacter species or from strains adapted to different electron acceptors can be compared to identify adaptations that optimize ATP synthesis under specific conditions.

    • Such studies could explain how Geobacter species can thrive in environments with low energy availability, such as during metal reduction .

These approaches can provide insights into how ATP synthesis is coupled to extracellular electron transfer, which is fundamental to understanding and optimizing Geobacter-based applications in bioremediation and bioelectricity production.

What role does atpB play in the adaptation of G. sulfurreducens to different electron acceptors?

The atpB subunit plays a significant role in G. sulfurreducens adaptation to different electron acceptors through several mechanisms:

  • Energetic efficiency adjustments:

    • Different electron acceptors (Fe(III), fumarate, electrodes, or Pd(II)) have varying redox potentials, affecting the energy available for ATP synthesis.

    • The regulation of atpB expression and potentially its functional properties may be optimized for the energetic constraints imposed by specific electron acceptors .

  • Transcriptional evidence:

    • Transcriptome studies have shown differential expression of ATP synthase genes, including atpB, when G. sulfurreducens is grown with different electron acceptors.

    • During Pd(II) reduction, ATP synthase subunits are downregulated, suggesting metabolic adaptation to this electron acceptor .

  • Connection to electron transfer pathways:

    • Different electron acceptors recruit specific electron transfer pathways in G. sulfurreducens:

      • ImcH is used for acceptors with redox potentials above -100 mV

      • CbcL for potentials between -100 and -210 mV

      • CbcBA for potentials below -210 mV

    • ATP synthesis through atpB-containing ATP synthase must be coordinated with these specific pathways to maintain energy balance.

  • Adaptive response evidence:

    • Long-term adaptation studies show that G. sulfurreducens undergoes species-level succession in biofilms, with different Geobacter species predominating based on electron acceptor conditions .

    • These adaptations likely involve optimizing the coupling between electron transfer and ATP synthesis, in which atpB plays a central role.

Understanding this adaptation is essential for predicting G. sulfurreducens performance in variable environments and for optimizing biotechnological applications involving different electron acceptors.

How can synthetic biology approaches utilizing recombinant atpB enhance the biotechnological applications of G. sulfurreducens?

Synthetic biology approaches utilizing recombinant atpB offer promising strategies to enhance G. sulfurreducens biotechnological applications:

  • Engineered ATP synthase variants:

    • Creating atpB variants with altered proton/ATP stoichiometry could optimize energy conservation for specific applications.

    • Engineering atpB to function optimally under specific pH or redox conditions could enhance performance in challenging environments.

  • Metabolic engineering strategies:

    • Precise control of atpB expression through synthetic promoters could balance energy generation with electron transfer rates.

    • Creating strains with tunable ATP demand, similar to the approach demonstrated by expressing the F1 portion of ATP synthase , could enhance electron transfer rates for improved bioremediation or electricity production.

  • Multi-species synthetic consortia:

    • Recombinant atpB variants optimized for different conditions could be introduced into different Geobacter strains to create specialized consortia for complex environmental applications.

    • Such consortia could perform more efficiently across varying redox potentials or contaminant types.

  • Biosensor development:

    • atpB function is linked to cellular energetics, which responds to extracellular electron acceptors.

    • Engineering reporter systems linked to atpB expression or ATP synthase activity could create biosensors for monitoring environmental conditions or bioremediation progress.

  • Cross-species functionality:

    • Chimeric ATP synthases incorporating atpB from G. sulfurreducens with components from other species could create hybrid systems with novel properties .

    • Such hybrids could enhance G. sulfurreducens performance in non-native environments or applications.

These approaches could significantly improve G. sulfurreducens applications in bioremediation of contaminated environments, electricity production in microbial fuel cells, biosensing, and sustainable bioprocessing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.