Recombinant Geobacter sulfurreducens Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lspA; GSU3135; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Target Names
lspA
Target Protein Sequence
MKPTYRIFNAVVLGSLVLDQATKVLIDRTMDLYQSIPVIDGLFSITYLRNRGAAFSFLAD FSYRLPFFILVSVVALGVIAVTFRKLRDDQHLAAAALALIFSGALGNLIDRVRLGEVIDF LDVYWKTYHWPAFNVADSAICVGVALLAVDMIREERRKAP
Uniprot No.

Target Background

Function

This protein is a recombinant Geobacter sulfurreducens lipoprotein signal peptidase (LspA) that specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links

KEGG: gsu:GSU3135

STRING: 243231.GSU3135

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Geobacter sulfurreducens and why is it significant in microbial research?

Geobacter sulfurreducens is an electroactive microorganism that has become a model organism for studying extracellular electron transfer. This bacterium is ubiquitous in soils and has the remarkable ability to "breathe" metals by transferring electrons to metallic minerals in natural environments . In engineered systems, G. sulfurreducens can respire an electrode to produce measurable electric current, effectively bridging the gap between biology and electrical signals . The organism's significance extends to its impact on the global iron cycle and its potential applications in bioelectrochemical systems.

G. sulfurreducens possesses unique metabolic characteristics, including an extensive network of cytochromes that facilitate its distinctive electron transfer capabilities. Cell composition analyses have shown that it contains unusually high amounts of iron (2 ± 0.2 μg/g dry weight) and lipids (32 ± 0.5% dry weight/dry weight), with this composition remaining consistent regardless of whether the cells are grown with soluble or insoluble electron acceptors . These distinctive characteristics make G. sulfurreducens an important subject for both fundamental microbiology research and applied biotechnological studies.

What is Lipoprotein Signal Peptidase (LspA) and what is its role in bacterial physiology?

Lipoprotein Signal Peptidase (LspA), also known as Signal Peptidase II, is an essential enzyme in the lipoprotein biosynthetic pathway of Gram-negative bacteria . LspA functions by cleaving the signal peptide from prolipoproteins after they have been lipidated by Lgt (lipoprotein diacylglyceryl transferase), producing mature lipoproteins that are critical for bacterial cell envelope integrity and function .

The essential nature of LspA for bacterial viability makes it an attractive target for antibacterial drug discovery, particularly against multi-drug-resistant Gram-negative bacteria . This has been demonstrated in assay systems where inhibition of LspA prevents the processing of prolipoproteins, which can be visualized as a molecular weight shift in gel electrophoresis analyses . The critical role of LspA in bacterial physiology is further emphasized by its conservation across bacterial species and the potential to develop broad-spectrum antibiotics targeting this enzyme.

How do lipoproteins and lipopolysaccharides interact in G. sulfurreducens?

In G. sulfurreducens, lipoproteins and lipopolysaccharides (LPS) are essential components of the cell envelope that influence the bacterium's interactions with its environment. Research has shown that G. sulfurreducens produces rough lipopolysaccharide (LPS) variants lacking the O-antigen typically found in many Gram-negative bacteria . This rough LPS structure may facilitate surface interactions with minerals and enhance metal reduction capabilities.

The interplay between lipoproteins (processed by LspA) and lipopolysaccharides likely contributes to the unique surface properties of G. sulfurreducens that enable its distinctive metal-reducing capabilities. Mutations affecting LPS structure have been shown to alter cell surface hydrophilicity, outer membrane vesiculation, and the ability to form electroactive biofilms , indicating the importance of proper cell envelope composition for G. sulfurreducens' characteristic metabolic functions.

What role might LspA play in G. sulfurreducens' extracellular electron transfer mechanisms?

G. sulfurreducens is renowned for its ability to transfer electrons to extracellular acceptors, a process that relies heavily on membrane-associated proteins. Given LspA's role in processing lipoproteins that are ultimately localized to the cell envelope, it likely plays an indirect but crucial role in establishing and maintaining the bacterium's extracellular electron transfer apparatus.

Research has demonstrated that G. sulfurreducens employs multiple periplasmic c-type cytochromes (including PpcA, PpcB, PpcC, PpcD, and PpcE) for electron transfer to various metal acceptors such as Fe(III), Mn(IV), U(VI), and V(V) . Experiments with deletion and reexpression of these cytochromes have shown remarkable redundancy, with PpcB, PpcC, PpcD, and PpcE all capable of supporting wild-type rates of both soluble and insoluble metal reduction when individually expressed in a strain lacking all five periplasmic cytochromes .

LspA may be involved in processing lipoproteins that interact with these cytochromes or that form part of the electron transfer chain extending from the periplasm to the cell exterior. Proper processing of such lipoproteins would be essential for the assembly and function of the electron transfer network that gives G. sulfurreducens its distinctive metabolic capabilities.

How might inhibition of LspA affect G. sulfurreducens' metal reduction capabilities?

Inhibition of LspA would likely disrupt the proper maturation of lipoproteins in G. sulfurreducens, potentially compromising the integrity and function of its cell envelope. Given the importance of surface structures for extracellular electron transfer, LspA inhibition could significantly impair the bacterium's metal reduction capabilities.

Research on LspA inhibitors in other bacteria has demonstrated that compounds such as globomycin and synthetic cyclic peptide analogues can effectively inhibit LspA function and exhibit antimicrobial activity . In G. sulfurreducens, similar inhibition would likely prevent the proper processing of lipoproteins involved in the extracellular electron transfer pathways, potentially disrupting the bacterium's ability to reduce metals and respire electrodes.

Studies on lipopolysaccharide mutations in G. sulfurreducens provide insights into how cell envelope disruptions affect its electron transfer capabilities. Mutations affecting LPS structure have been shown to disrupt the development and structure of electroactive biofilms, although they do not substantially impact planktonic growth . Similar effects might be expected from LspA inhibition, potentially disrupting the bacterium's ability to form the structured communities necessary for efficient extracellular electron transfer.

What expression systems are suitable for producing recombinant G. sulfurreducens LspA?

For recombinant expression of G. sulfurreducens LspA, researchers should consider several expression systems based on the properties of membrane proteins and the specific characteristics of G. sulfurreducens proteins:

  • E. coli expression systems: Standard systems like BL21(DE3) with pET vectors can be used for initial expression attempts, but may require optimization due to the membrane-associated nature of LspA.

  • Cell-free expression systems: These can be advantageous for membrane proteins like LspA, allowing direct incorporation into liposomes or nanodiscs.

  • Homologous expression in Geobacter species: This approach may preserve native folding and post-translational modifications, though it typically yields lower protein amounts.

When designing expression constructs, inclusion of fusion tags (such as His6, MBP, or SUMO) can facilitate purification while potentially enhancing solubility. Expression conditions should be carefully optimized, with particular attention to temperature (often lowered to 16-20°C for membrane proteins), inducer concentration, and expression duration to maximize properly folded protein yield.

The high iron content characteristic of G. sulfurreducens (2 ± 0.2 μg/g dry weight) suggests that supplementation of expression media with iron salts might improve the production of properly folded metalloproteins, including LspA if it contains metal cofactors.

What purification and characterization methods are effective for recombinant G. sulfurreducens LspA?

Purification of recombinant G. sulfurreducens LspA requires specialized approaches due to its membrane-associated nature:

Purification protocol:

  • Cell lysis: Gentle lysis methods using enzymatic treatments combined with mechanical disruption

  • Membrane fraction isolation: Ultracentrifugation to separate membrane fractions

  • Detergent solubilization: Screening multiple detergents (DDM, LMNG, CHAPS) for optimal extraction

  • Affinity chromatography: Utilizing fusion tags for initial purification

  • Size exclusion chromatography: For final polishing and buffer exchange

For functional characterization, researchers can adapt assays developed for other bacterial LspA enzymes, such as the SDS-PAGE gel-shift assay described in the literature . In this assay, a substrate prolipoprotein (like prepro inhibitor of cysteine protease, ppICP) is first lipidated by Lgt using a lipid substrate like dioleoylphosphatidylglycerol (DOPG). LspA then cleaves the signal peptide from the lipidated prolipoprotein, resulting in a molecular weight shift of approximately 10 kDa that can be visualized by SDS-PAGE .

Additionally, fluorescence resonance energy transfer (FRET)-based assays can be developed using labeled synthetic peptide substrates to provide real-time monitoring of LspA activity, facilitating kinetic analyses and inhibitor screening.

How can researchers assess the impact of LspA modifications on G. sulfurreducens' electroactive properties?

Assessing the impact of LspA modifications on G. sulfurreducens' electroactive properties requires a multi-faceted approach combining genetic, biochemical, and electrochemical techniques:

Genetic approaches:

  • Generation of LspA variants through site-directed mutagenesis

  • Construction of conditional expression strains to control LspA levels

  • Creation of chimeric LspA proteins to investigate domain-specific functions

Phenotypic characterization:

  • Growth rate analysis with different electron acceptors (fumarate, Fe(III) citrate, Fe(III) oxide)

  • Quantification of metal reduction rates using colorimetric assays

  • Evaluation of biofilm formation on different surfaces

Electrochemical techniques:

  • Chronoamperometry to measure current production on electrodes

  • Cyclic voltammetry to assess redox properties

  • Electrochemical impedance spectroscopy to characterize electron transfer kinetics

A comprehensive experimental design might include comparing wild-type G. sulfurreducens with strains expressing modified LspA variants across various growth conditions. Similar approaches have been used to study periplasmic cytochromes, where deletion and reexpression experiments revealed functional redundancy among these electron carriers .

For electrode respiration experiments, researchers should consider the unique cell composition of G. sulfurreducens, including its high lipid content (32 ± 0.5% dry weight/dry weight) , which might influence membrane properties and electron transfer capabilities.

How can computational approaches enhance the study of G. sulfurreducens LspA?

Computational approaches offer powerful tools for studying G. sulfurreducens LspA without requiring extensive experimental resources:

Structural modeling approaches:

  • Homology modeling based on existing bacterial LspA structures

  • Molecular dynamics simulations to understand membrane integration and dynamics

  • Substrate docking studies to predict lipoprotein signal peptide interactions

Functional prediction methods:

  • Genomic context analysis to identify potential functional associations

  • Evolutionary analysis to identify conserved catalytic residues

  • Systems biology approaches to position LspA within cellular networks

The successful application of computational design in developing cyclic peptide inhibitors of LspA from other bacteria demonstrates the potential of these approaches . Researchers achieved potent inhibitors with IC50 values in the single-digit μM range in the first round of designs, with second-round compounds reaching high nM potency . This approximately 10-fold increase in potency was achieved over just two generations, requiring the synthesis of only 12 compounds .

Similar computational approaches could be applied to G. sulfurreducens LspA to predict structure, identify potential inhibitors, and understand its role in the bacterium's unique physiology, potentially leading to insights without the need for extensive experimental work.

What implications might G. sulfurreducens LspA research have for bioelectrochemical applications?

Research on G. sulfurreducens LspA has significant implications for bioelectrochemical applications, particularly in the development and optimization of microbial fuel cells and biosensors:

Potential applications:

  • Enhanced biofilm formation: Understanding and optimizing lipoprotein processing could improve electrode colonization and biofilm stability

  • Increased current density: Engineered LspA variants might facilitate better electron transfer to electrodes

  • Controlled protein display: LspA-dependent lipoprotein anchoring could be exploited for surface display of functional proteins

  • Biosensor development: Manipulated LspA activity could yield G. sulfurreducens strains with tailored sensing capabilities

G. sulfurreducens' ability to respire electrodes makes it particularly valuable for bioelectrochemical applications . Research on the bacterium's cell envelope components, including lipopolysaccharides, has shown that mutations affecting these structures can disrupt the developmental stages and structure of electroactive biofilms .

Understanding LspA's role in processing lipoproteins that may be involved in electrode interactions could lead to engineered strains with enhanced electron transfer capabilities. This could potentially address current limitations in microbial fuel cell technology, such as low power density and inconsistent performance.

How might LspA inhibitors be leveraged for studying G. sulfurreducens physiology?

LspA inhibitors represent valuable chemical tools for studying G. sulfurreducens physiology by allowing researchers to selectively disrupt lipoprotein processing:

Research applications of LspA inhibitors:

Inhibitor TypeApplicationExpected OutcomeAnalytical Method
Natural products (e.g., globomycin)Acute inhibition studiesRapid disruption of lipoprotein processingProteomic analysis of lipoprotein profiles
Synthetic cyclic peptidesDose-dependent studiesControlled modulation of LspA activityGrowth curve analysis with various electron acceptors
Computationally designed analoguesStructure-activity relationship studiesIdentification of critical LspA functional domainsElectron microscopy of cell envelope structures
Photoaffinity probesIn situ target engagement studiesIdentification of LspA interaction partnersMass spectrometry of crosslinked complexes

Research on LspA inhibitors in other bacteria has demonstrated that both natural products like globomycin and synthetic analogues can effectively inhibit LspA function . The development of cyclic peptide inhibitors using computational design approaches has yielded compounds with antimicrobial activity comparable to or better than globomycin against ESKAPE-E pathogens .

Similar inhibitors could be applied to G. sulfurreducens to investigate the role of LspA in its unique physiology. By selectively inhibiting LspA and observing the effects on growth, metal reduction, and electrode respiration, researchers could gain insights into the importance of lipoprotein processing for G. sulfurreducens' distinctive metabolic capabilities.

What are common challenges in expressing and purifying recombinant G. sulfurreducens LspA?

Researchers working with recombinant G. sulfurreducens LspA face several challenges inherent to membrane protein biochemistry and the unique characteristics of this bacterium:

Expression challenges:

  • Low expression yields: As a membrane protein, LspA may express poorly in heterologous systems

  • Protein misfolding: The reducing periplasmic environment of G. sulfurreducens may differ from expression hosts

  • Toxicity to host cells: Overexpression of membrane proteases can disrupt host cell membranes

  • Codon bias: G. sulfurreducens' distinctive GC content may require codon optimization

Purification challenges:

  • Detergent selection: Finding detergents that extract LspA while maintaining activity

  • Protein stability: Maintaining stability during purification steps

  • Activity preservation: Ensuring the purified enzyme retains catalytic function

  • Aggregation issues: Preventing protein aggregation during concentration steps

To address these challenges, researchers should consider a systematic optimization approach, testing multiple expression systems, detergents, and buffer conditions. The high lipid content of G. sulfurreducens (32 ± 0.5% dry weight/dry weight) suggests that lipid supplementation during purification might enhance LspA stability and activity. Additionally, incorporation of the purified protein into nanodiscs or liposomes might better mimic its native membrane environment.

How can researchers overcome the complexity of studying LspA in G. sulfurreducens' unique cellular context?

Studying LspA within G. sulfurreducens' unique cellular context presents distinct challenges due to the bacterium's specialized metabolism and cell envelope properties:

Methodological approaches to overcome complexity:

  • Development of genetic tools specific to G. sulfurreducens:

    • Optimization of transformation protocols for higher efficiency

    • Creation of inducible expression systems compatible with G. sulfurreducens

    • Development of CRISPR-Cas9 systems adapted for Geobacter species

  • In situ activity assays:

    • Fluorescent reporter systems to monitor LspA activity in living cells

    • Development of activity-based protein profiling probes specific for LspA

    • Adaptation of proteomic approaches to track lipoprotein processing

  • Integration of multiple analytical techniques:

    • Combining electron microscopy with functional assays

    • Correlating gene expression data with metabolic activities

    • Using systems biology approaches to position LspA within cellular networks

Studies on G. sulfurreducens have demonstrated the complexity of its cellular processes, including the adaptive synthesis of lipopolysaccharides under different growth conditions and the functional redundancy among periplasmic cytochromes . Similar complexity likely extends to lipoprotein processing by LspA, requiring integrated approaches that combine genetic, biochemical, and physiological analyses.

What controls and validation methods are essential when studying recombinant G. sulfurreducens LspA?

Rigorous controls and validation methods are essential for ensuring reliable results when studying recombinant G. sulfurreducens LspA:

Essential controls and validation methods:

  • Activity validation:

    • Comparison with well-characterized LspA from model organisms

    • Site-directed mutagenesis of predicted catalytic residues

    • Inhibition studies using known LspA inhibitors like globomycin

  • Structural validation:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to evaluate protein stability

  • Functional complementation:

    • Expression of recombinant LspA in LspA-deficient bacterial strains

    • Restoration of lipoprotein processing in complemented strains

    • Comparison of growth phenotypes between wild-type and complemented strains

  • Specificity controls:

    • Testing activity against non-lipoprotein substrates

    • Competition assays with known substrates

    • Comparing activity with structurally related but functionally distinct signal peptidases

For activity assays, researchers can adapt methodologies like the gel-shift assay described in the literature, where LspA activity is monitored by tracking the molecular weight shift of processed lipoproteins using SDS-PAGE . FRET-based assays with labeled synthetic peptide substrates can provide more quantitative measures of enzyme kinetics and inhibitor efficacy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.