Recombinant Geobacter sulfurreducens NADH-quinone oxidoreductase subunit A 1 (nuoA1)

Shipped with Ice Packs
In Stock

Description

Functional Role in G. sulfurreducens Metabolism

nuoA1 is a core component of the NDH-1 complex, which shuttles electrons from NADH to ubiquinone while translocating four protons across the membrane for every two electrons transferred . In G. sulfurreducens, this complex is integral to:

  • Electron Transport: Facilitating energy conversion in the respiratory chain .

  • Electroactivity: Supporting extracellular electron transfer (EET) in bioelectrochemical systems, though direct evidence for nuoA1’s role in EET remains under investigation .

  • Proton Gradient Generation: Contributing to ATP synthesis via oxidative phosphorylation .

Table 2: Functional Comparison of NDH-1 Subunits

SubunitRoleKey Features
nuoA1FMN/Fe-S cluster binding, electron transferFull-length (1-118 aa), His-tagged
nuoK2Quinone-binding siteFull-length (1-102 aa), His-tagged
nuoHATPase subunitNot characterized in G. sulfurreducens

Immunoassays

ELISA kits targeting nuoA1 (e.g., CSB-CF748273GBK) are used to detect protein expression levels in G. sulfurreducens cultures or engineered strains, aiding studies on metabolic regulation .

Bioelectrochemical Systems

While cytochromes (e.g., PpcA family) dominate EET in G. sulfurreducens, nuoA1’s role in intracellular electron routing may influence cathode colonization in microbial fuel cells .

Gene and Protein Information

ParameterDetails
Gene NamenuoA1
LocusGSU0338
EC Number1.6.99.5 (NADH dehydrogenase)
Alternative NamesNADH dehydrogenase I subunit A 1; NDH-1 subunit A 1

Production and Purification

The His-tagged nuoA1 is expressed in E. coli, purified via nickel affinity chromatography, and stabilized in Tris-based buffers with trehalose to prevent aggregation . Reconstitution in deionized water (0.1–1.0 mg/mL) with optional glycerol (5–50%) is recommended for long-term storage .

Comparative Insights with Other G. sulfurreducens Proteins

While cytochromes (e.g., GSU0105) dominate EET, nuoA1 operates upstream in the respiratory chain. Unlike single-subunit NADH dehydrogenases (e.g., yeast Ndi1), nuoA1 requires assembly with other NDH-1 subunits for functionality .

Challenges and Future Directions

  • Structural Elucidation: Crystallization of nuoA1 remains challenging due to its transmembrane nature, limiting insights into ligand binding.

  • EET Integration: Investigating cross-talk between NDH-1 and periplasmic cytochromes could optimize bioelectrochemical systems.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your use.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
nuoA1; GSU0338; NADH-quinone oxidoreductase subunit A 1; NADH dehydrogenase I subunit A 1; NDH-1 subunit A 1; NUO1 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Target Names
nuoA1
Target Protein Sequence
MLGVYLPIIVLVAVAVIFGLASLTFSSLIGQKKPSAVKLAPYECGCEPVGSARERFSVKF YIIAMLFILFDIEAVFMYPWSVLFKRLGIFGVVEMGLFIVILFVGYIYVWKKGALEWE
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation; specifically, four protons are translocated across the cytoplasmic membrane for every two electrons transferred. This process harnesses redox energy to generate a proton gradient.
Database Links

KEGG: gsu:GSU0338

STRING: 243231.GSU0338

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the significance of Geobacter sulfurreducens in environmental microbiology?

Geobacter sulfurreducens represents a critical model organism for studying dissimilatory metal-reducing microorganisms. These bacteria play essential roles in organic matter and mineral cycling in aquatic sediments, submerged soils, and subsurface environments. G. sulfurreducens has gained particular attention for its applications in bioremediation of both organic compounds and metal contaminants. The organism was initially isolated from hydrocarbon-contaminated soil and possesses key metabolic features characteristic of the Geobacter genus, including the ability to oxidize monoaromatic compounds while using metals as electron acceptors . Furthermore, G. sulfurreducens can utilize fumarate as a sole electron acceptor, enabling the generation of mutants that are defective in electron transfer to metals and humic substances for detailed mechanistic studies .

How does NADH-quinone oxidoreductase function in G. sulfurreducens?

While the search results don't specifically detail the function of NADH-quinone oxidoreductase in G. sulfurreducens, we can extrapolate based on homologous systems. NADH-quinone oxidoreductase (also known as Complex I) functions as the entry point for electrons into the respiratory chain. Similar to the well-characterized NDUFA1 in other organisms, G. sulfurreducens nuoA1 likely contributes to an L-shaped protein complex comprising a hydrophobic transmembrane domain and a hydrophilic peripheral arm containing redox centers and the NADH binding site . The complex catalyzes electron transfer from NADH to ubiquinone, coupling this process to proton translocation across the membrane. This electron transfer is fundamental to energy conservation mechanisms in this organism, particularly in its anaerobic respiration pathways that involve various terminal electron acceptors including metals and fumarate.

What are the genomic characteristics of nuoA1 in G. sulfurreducens?

Based on comparative genomics, the nuoA1 gene in G. sulfurreducens likely encodes a subunit of the NADH-quinone oxidoreductase (Complex I). While specific details about nuoA1 are not provided in the search results, related research indicates that in some bacteria, complex I genes are organized in operons. For instance, in Aquifex aeolicus, certain subunit genes like nuoD2/nuoD1 are fused into one gene, which contradicts the organization observed in most other bacteria where these genes are part of a single operon . This suggests that G. sulfurreducens might have unique genomic arrangements for its complex I genes, potentially including multiple isoforms of certain subunits like nuoA.

What are effective methods for genetic manipulation of G. sulfurreducens for nuoA1 studies?

Genetic manipulation of G. sulfurreducens requires specialized techniques due to its anaerobic nature. An established approach involves electroporation for introducing foreign DNA. This technique has been successfully used for gene disruptions in G. sulfurreducens, as demonstrated in studies targeting the nifD gene . The protocol involves:

  • Determining antibiotic sensitivity profiles for selection marker optimization

  • Establishing optimal plating conditions for high efficiency colony formation

  • Developing specific electroporation parameters for introducing DNA into G. sulfurreducens

  • Using broad-host-range vectors, particularly IncQ and pBBR1 vectors which replicate in G. sulfurreducens

  • Employing the IncQ plasmid pCD342 as an expression vector

  • Implementing single-step gene replacement methods for targeted gene disruption

These methodologies can be adapted for nuoA1 studies, enabling gene knockout, complementation, or expression of modified versions to investigate function .

What heterologous expression systems are suitable for producing recombinant G. sulfurreducens nuoA1?

Based on related studies with complex I subunits, E. coli expression systems appear suitable for heterologous production of G. sulfurreducens nuoA1. Research with A. aeolicus complex I components suggests that E. coli deletion strains could be effectively used for expression of foreign respiratory chain components . The following approach is recommended:

  • Design expression vectors containing the nuoA1 gene with appropriate fusion tags (e.g., Strep-tag) for purification

  • Transform these vectors into E. coli strains lacking endogenous nuo genes (e.g., nuo-deletion strain similar to BA14) to prevent interference from host proteins

  • Optimize induction conditions for protein expression

  • Purify the recombinant protein using anion exchange chromatography followed by affinity chromatography (e.g., Strep-Tactin)

This approach should yield purified recombinant nuoA1 suitable for structural and functional characterization.

How can complementation studies confirm nuoA1 function in G. sulfurreducens?

Complementation studies provide crucial evidence for gene function. Based on methodology used for nifD in G. sulfurreducens, a similar approach for nuoA1 would involve:

  • Creating a nuoA1 knockout strain through targeted gene disruption

  • Characterizing the resulting phenotype, particularly focusing on defects in electron transport, growth rates, or metabolic capabilities

  • Constructing an expression vector containing a functional copy of nuoA1

  • Introducing this vector into the knockout strain via electroporation

  • Assessing restoration of wild-type phenotypes in the complemented strain

Successful complementation that restores wild-type characteristics would confirm the specific function of nuoA1 in G. sulfurreducens .

What approaches are effective for structural characterization of recombinant nuoA1?

Structural characterization of recombinant nuoA1 can be approached through multiple techniques, drawing from methods used for related proteins:

  • Electron microscopic single-particle analysis: This technique has been successfully applied to complex I components and can provide valuable insights into the structural arrangement of nuoA1 within the larger complex .

  • X-ray crystallography: While challenging for membrane proteins, this approach can yield high-resolution structural data as demonstrated with related proteins like AhpC2 .

  • Structure prediction and modeling: Computational approaches comparing nuoA1 to homologous subunits from other organisms can provide insights into domain organization and potential functional regions.

  • Domain analysis: Similar to NDUFA1, nuoA1 likely contains hydrophobic transmembrane regions that anchor the protein and hydrophilic domains that interact with other complex I subunits. Analyzing these domains can provide functional insights .

These approaches, used in combination, would provide comprehensive structural information about nuoA1 and its integration into the NADH-quinone oxidoreductase complex.

How can researchers assess electron transfer activity of recombinant nuoA1?

Evaluation of electron transfer activity requires specialized techniques suitable for anaerobic proteins involved in respiration:

  • EPR spectroscopy: This technique can identify Fe-S clusters and monitor electron transfer events, as demonstrated with complex I from A. aeolicus .

  • Activity assays: Measuring NADH oxidation coupled to artificial electron acceptors can quantify electron transfer rates.

  • Redox potential determination: Techniques used for related proteins like AhpC2 can be adapted to determine the redox properties of nuoA1 and its contribution to electron transfer chains .

  • Reconstitution experiments: Incorporating purified recombinant nuoA1 into liposomes or with other purified complex I components to assess functionality in a controlled system.

These approaches provide quantitative and qualitative data on electron transfer functionality, essential for understanding nuoA1's role in G. sulfurreducens energy metabolism.

What techniques can identify protein-protein interactions involving nuoA1 in the NADH-quinone oxidoreductase complex?

Understanding protein-protein interactions is crucial for elucidating nuoA1's role within the complex:

  • Co-immunoprecipitation: Using antibodies against nuoA1 or other complex components to identify interacting proteins, though optimization of antibody specificity and binding conditions is critical .

  • Cross-linking mass spectrometry: This approach can capture transient interactions and identify specific interaction sites between nuoA1 and other proteins.

  • Blue native PAGE: This technique preserves native protein complexes and can identify subcomplex formations involving nuoA1.

  • Yeast two-hybrid or bacterial two-hybrid systems: These could identify specific interacting partners, though they may require modifications for membrane proteins.

  • Split-GFP complementation: This approach can visualize protein interactions in vivo when traditional methods are challenging.

Each technique provides complementary information about nuoA1's interactions within the complex I architecture.

How can N of 1 trials be applied to study functional variability in recombinant nuoA1 variants?

N of 1 trials offer a powerful approach to studying individual variants of nuoA1:

  • Experimental design: Implement multiple crossover designs where different nuoA1 variants are systematically compared within a controlled expression system .

  • Randomization and blinding: Where possible, use randomized ordering of variant testing and blinded analysis to minimize bias .

  • Washout periods: Include appropriate intervals between testing different variants to ensure complete clearance of previous proteins .

  • Quantitative measurements: Define clear, reproducible metrics of function (electron transfer rates, complex assembly efficiency, growth complementation) for comparison.

  • Statistical analysis: Apply appropriate statistical methods for N of 1 designs, focusing on effect size estimation rather than traditional hypothesis testing alone.

This approach is particularly valuable for studying subtle functional differences between naturally occurring or engineered nuoA1 variants, providing insights into structure-function relationships at the molecular level .

What are the optimal conditions for purifying active recombinant nuoA1?

Purification of active membrane proteins requires specialized approaches:

  • Solubilization optimization: Test multiple detergents (DDM, LMNG, digitonin) at various concentrations to maintain protein stability and activity.

  • Chromatography strategy: Implement a multi-step purification process, potentially including:

    • Ion exchange chromatography (e.g., anion exchange)

    • Affinity chromatography (utilizing fusion tags such as Strep-tag)

    • Size exclusion chromatography for final polishing

  • Buffer optimization: Maintain anaerobic conditions and include appropriate stabilizers such as glycerol or specific lipids throughout purification.

  • Activity preservation: Monitor activity throughout purification steps to ensure functionality is maintained.

  • Storage conditions: Determine optimal conditions for long-term storage that preserve structural integrity and activity.

These considerations are essential for obtaining pure, active nuoA1 suitable for downstream structural and functional analyses.

How can isotope labeling facilitate structural studies of recombinant nuoA1?

Isotope labeling provides powerful tools for structural analysis:

  • 15N/13C labeling: Growth of expression hosts in minimal media with isotope-enriched nitrogen and carbon sources enables NMR spectroscopy studies of protein structure.

  • Selective labeling: Incorporation of specific labeled amino acids can highlight functional domains or interaction surfaces.

  • Deuteration: Growth in D2O-based media can improve signal quality in certain structural studies, particularly for larger complexes.

  • Fe-S cluster analysis: Incorporation of 57Fe into Fe-S clusters can enhance EPR signal detection for studying these redox-active centers, which may interact with nuoA1 .

  • Cross-linking studies: Isotope-labeled cross-linkers can facilitate identification of interaction partners and contact points through mass spectrometry.

These approaches provide detailed structural information that complements other characterization methods.

How does nuoA1 contribute to the bioremediation capabilities of G. sulfurreducens?

The nuoA1 subunit likely plays a crucial role in G. sulfurreducens' bioremediation applications:

  • Electron transport to metals: As part of the NADH-quinone oxidoreductase complex, nuoA1 likely contributes to the electron transport chain that ultimately delivers electrons to metals during bioremediation processes .

  • Energy conservation: By participating in proton translocation coupled to electron transfer, nuoA1 helps maintain energy balance during growth on contaminants.

  • Adaptation to environments: Study of nuoA1 variants may reveal adaptations that enhance performance in contaminated environments with varying redox conditions.

  • Integration with nitrogen fixation: G. sulfurreducens' ability to fix nitrogen is advantageous in carbon-rich, nitrogen-poor environments like petroleum-contaminated sites. Understanding how electron transport through nuoA1 integrates with nitrogen fixation could optimize bioremediation strategies .

  • Oxidation of aromatic compounds: Investigating how nuoA1 contributes to the oxidation of monoaromatic compounds would provide insights into bioremediation mechanisms for organic contaminants .

Research targeting these aspects could enhance the application of G. sulfurreducens in environmental restoration projects.

How can site-directed mutagenesis of nuoA1 elucidate electron transfer mechanisms?

Site-directed mutagenesis provides a powerful approach to understanding nuoA1 function:

  • Target selection: Identify conserved residues in nuoA1 based on sequence alignments with homologous proteins like NDUFA1.

  • Mutation design: Create specific amino acid substitutions that:

    • Alter hydrophobicity of membrane-spanning regions

    • Modify charged residues at potential interaction surfaces

    • Change potential metal-binding sites

    • Introduce reporter groups for spectroscopic studies

  • Functional assessment: Evaluate mutants for:

    • Assembly into the complete complex

    • NADH oxidation rates

    • Proton pumping efficiency

    • Electron transfer to downstream acceptors

  • Structural impact: Use techniques like circular dichroism or limited proteolysis to assess structural changes resulting from mutations.

  • In vivo significance: Test the ability of mutant constructs to complement nuoA1 deletion strains.

This systematic approach can map functional domains and identify key residues involved in electron transfer, providing mechanistic insights at the molecular level.

What roles might nuoA1 isoforms play in adaptation to different environmental conditions?

The presence of multiple complex I isoforms in certain bacteria suggests nuoA1 variants may serve specialized functions:

  • Expression analysis: Quantify expression levels of nuoA1 variants under different growth conditions (varying electron acceptors, nutrient availability, stress conditions) using RT-qPCR or proteomics.

  • Isoform separation: Develop methods to distinguish between potential isoforms, such as immunoprecipitation with isoform-specific antibodies .

  • Functional comparisons: Characterize kinetic parameters and substrate preferences of different isoforms under varying conditions.

  • Evolutionary analysis: Compare nuoA1 sequences across Geobacter species from different environments to identify adaptive variations.

  • Heterologous expression: Express individual isoforms in appropriate host systems for comparative biochemical characterization .

Understanding isoform specialization could reveal adaptations that enhance G. sulfurreducens' versatility in diverse environmental niches.

How can researchers address common challenges in heterologous expression of nuoA1?

Heterologous expression of membrane proteins like nuoA1 presents several challenges:

  • Inclusion body formation: Optimize growth temperature (typically lowering to 16-20°C), inducer concentration, and consider fusion partners like MBP that enhance solubility.

  • Toxicity to host cells: Use tightly regulated expression systems and consider specialized E. coli strains like C41(DE3) or C43(DE3) designed for toxic membrane proteins.

  • Improper membrane insertion: Co-express chaperones specific for membrane proteins or use E. coli strains with enhanced membrane protein expression capabilities.

  • Low yield: Scale up culture volumes, optimize media composition, and consider fed-batch cultivation strategies to increase biomass.

  • Protein instability: Include appropriate protease inhibitors, optimize buffer composition, and maintain anaerobic conditions throughout purification if required.

Systematic optimization of these parameters should overcome common expression challenges.

What statistical approaches are appropriate for analyzing nuoA1 structure-function relationships?

Rigorous statistical analysis is essential for structure-function studies:

  • Multivariable analysis: Apply methods like principal component analysis to identify correlations between structural features and functional parameters.

  • Repeated measures designs: For studies testing multiple variants or conditions on the same protein preparation, use appropriate repeated measures statistical tests.

  • Bayesian approaches: Consider Bayesian statistics for complex datasets, particularly when integrating multiple types of structural and functional data.

  • N of 1 trial analysis: For detailed studies of individual variants, apply statistical methods designed for N of 1 trials that account for time-series data and crossover designs .

  • Machine learning: For complex datasets integrating sequence, structure, and function, machine learning approaches can identify non-obvious patterns and relationships.

How can researchers validate that recombinant nuoA1 maintains native conformation and function?

Confirming that recombinant nuoA1 represents the native protein is crucial:

  • Spectroscopic characterization: Compare spectroscopic properties (UV-vis, CD, fluorescence) with native complex I preparations from G. sulfurreducens.

  • Antibody recognition: Use antibodies raised against native protein to confirm structural epitopes are preserved in recombinant protein.

  • Activity assays: Compare specific activities of recombinant protein with those of native complexes isolated from G. sulfurreducens.

  • Reconstitution experiments: Test the ability of recombinant nuoA1 to complement subcomplexes lacking this subunit.

  • Proteoliposome studies: Incorporate recombinant protein into liposomes and assess functional parameters like proton pumping to confirm native-like behavior.

  • Thermal stability: Compare thermal denaturation profiles between recombinant and native proteins as an indicator of proper folding.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.