Recombinant Geobacter sulfurreducens NADH-quinone oxidoreductase subunit A 2 (nuoA2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
nuoA2; GSU3445; NADH-quinone oxidoreductase subunit A 2; NADH dehydrogenase I subunit A 2; NDH-1 subunit A 2; NUO1 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Target Names
nuoA2
Target Protein Sequence
MQPAGISHSLFPSLPPEFLPLALYTLAASILIGVLLLAAWWLGAKTTNRNKELPYESGAI PTGSARLAYPVPFYLIAIFFIVFDVEAAFIFAWATAWRELGLQGLVHITFFIVILLLGLV WLWLKGGLDWGPSRARRGHVRD
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy within a proton gradient.
Database Links

KEGG: gsu:GSU3445

STRING: 243231.GSU3445

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What role does nuoA2 play in the electron transport chain of G. sulfurreducens?

NuoA2 functions as a critical component in the NADH dehydrogenase (Complex I) of G. sulfurreducens, which is central to its electron transport capabilities and energy conservation. In the electron transport chain, it participates in:

  • Menaquinone reduction: The NADH dehydrogenase complex transfers electrons from NADH to the menaquinone pool, with nuoA2 potentially forming part of the quinone-binding site.

  • Proton translocation: The complex contributes to creating a proton motive force by coupling electron transfer to proton pumping across the inner membrane.

  • Metabolic versatility: As part of G. sulfurreducens' respiratory machinery, nuoA2 enables the bacterium to couple the oxidation of acetate, formate, and hydrogen to various terminal electron acceptors.

Recent evidence suggests that the NADH dehydrogenase complex, including nuoA2, forms part of a redox loop with other membrane proteins such as ImcH, which is crucial for extracellular electron transfer processes. The electrons from carbon metabolism are shuttled through NADH, which is oxidized at Complex I on the N-side of the membrane with proton pumping, contributing to energy conservation .

What are the optimal expression conditions for producing recombinant nuoA2 protein in E. coli?

Based on established protocols for similar G. sulfurreducens proteins, the optimal expression conditions for recombinant nuoA2 protein in E. coli are:

Host strain selection:

  • BL21(DE3) or C43(DE3) strains are recommended for membrane protein expression

  • Co-transformation with a plasmid containing the cytochrome c maturation system (ccmABCDEFGH) may enhance proper folding if heme groups are involved

Expression vector and tagging strategy:

  • Use a pET-based vector with T7 promoter

  • N-terminal His-tagging can interfere with membrane insertion; C-terminal His-tag is preferable

  • Include a TEV protease cleavage site if tag removal is desired

Growth conditions:

  • Culture in TB or 2×YT medium supplemented with appropriate antibiotics

  • Grow at 37°C until OD600 reaches 0.6-0.8

  • Induce expression with 0.1-0.5 mM IPTG

  • Shift temperature to 16-18°C post-induction

  • Continue expression for 16-24 hours

Media additives:

  • Add 5-10 μM δ-aminolevulinic acid if heme incorporation is needed

  • Supplement with iron (50-100 μM FeSO4) if iron-sulfur clusters are present

It's important to note that based on experiences with other Geobacter proteins, untagged versions may provide better yield of fully mature protein compared to N-terminal His-tagged constructs . Monitoring expression by SDS-PAGE and Western blotting is essential to optimize conditions for maximum protein yield.

What challenges are associated with purifying functional nuoA2, and how can researchers overcome them?

Purification of functional nuoA2 presents several significant challenges due to its hydrophobic nature and membrane localization:

Challenge 1: Membrane extraction

  • Solution: Use a two-step solubilization process with 1% DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) at 4°C for 2-3 hours, followed by overnight incubation with a milder detergent like 0.05% DDM.

  • Methodology: After cell disruption by French press or sonication, separate membrane fractions by ultracentrifugation (100,000 × g, 1 h) before detergent solubilization.

Challenge 2: Maintaining protein stability

  • Solution: Add 10-20% glycerol and 1 mM DTT to all buffers to prevent aggregation and oxidation.

  • Methodology: Conduct all purification steps at 4°C and include protease inhibitors in the lysis buffer.

Challenge 3: Preserving native conformation

  • Solution: Use affinity chromatography followed by size exclusion chromatography.

  • Methodology: For His-tagged protein, use Ni-NTA resin with gradient elution (20-250 mM imidazole) to minimize non-specific binding. Follow with gel filtration using Superdex 200 in buffer containing 0.02% DDM.

Challenge 4: Assessing functionality

  • Solution: Develop activity assays to confirm electron transfer capability.

  • Methodology: Measure NADH oxidation rates spectrophotometrically at 340 nm or use artificial electron acceptors like ferricyanide.

Challenge 5: Storage stability

  • Solution: Store purified protein in buffer containing 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 0.02% DDM, 20% glycerol, and 1 mM DTT.

  • Methodology: Aliquot and flash-freeze in liquid nitrogen, then store at -80°C to prevent freeze-thaw cycles .

Researchers should validate protein quality through circular dichroism spectroscopy to confirm secondary structure integrity, and consider reconstitution into nanodiscs or liposomes for functional studies.

How can researchers use recombinant nuoA2 to investigate the electron transfer mechanisms in G. sulfurreducens?

Recombinant nuoA2 serves as a valuable tool for investigating electron transfer mechanisms in G. sulfurreducens through several experimental approaches:

Reconstitution studies:

  • Incorporate purified nuoA2 into proteoliposomes along with other components of the NADH dehydrogenase complex

  • Measure electron transfer rates using NADH as electron donor and various quinone analogs as acceptors

  • Assess the impact of membrane potential on electron transfer efficiency

Interaction analysis:

  • Perform pull-down assays with tagged nuoA2 to identify interaction partners

  • Use surface plasmon resonance (SPR) or microscale thermophoresis (MST) to quantify binding affinities with other components of the electron transport chain

  • Employ crosslinking coupled with mass spectrometry to map the protein-protein interfaces

Electrochemical measurements:

  • Immobilize nuoA2-containing proteoliposomes on electrodes

  • Conduct cyclic voltammetry to determine redox potentials

  • Perform chronoamperometry to measure sustained electron transfer capabilities

Mutational analysis:

  • Generate site-directed mutations in conserved residues

  • Express and purify mutant proteins

  • Compare electron transfer rates and partner interactions to identify critical functional domains

This approach has proven valuable in understanding the electron transfer mechanisms in G. sulfurreducens, as demonstrated by similar studies with the inner membrane cytochrome ImcH, which revealed its role in menaquinol oxidation and proton transfer to the periplasm . The function of nuoA2 in the NADH dehydrogenase complex can be similarly elucidated, providing insights into how electrons from carbon metabolism are shuttled through NADH and ultimately to extracellular electron acceptors.

What is the relationship between nuoA2 and other components of the electron transport chain in G. sulfurreducens under different growth conditions?

The relationship between nuoA2 and other components of the electron transport chain in G. sulfurreducens is dynamic and depends significantly on growth conditions and available electron acceptors:

Anaerobic respiration with Fe(III):
Under Fe(III)-reducing conditions, nuoA2 functions within the NADH dehydrogenase complex to transfer electrons from central metabolism to the menaquinone pool. These electrons are then shuttled through a series of periplasmic and outer membrane cytochromes. In this pathway:

  • NuoA2 participates in electron transfer to menaquinones

  • Reduced menaquinones are oxidized by ImcH (E° > -100 mV) or CbcL (E° between -100 and -210 mV)

  • Electrons flow to periplasmic cytochromes (primarily PpcA family)

  • Finally, outer membrane cytochromes transfer electrons to Fe(III)

Electrode respiration:
When growing on electrodes, the expression levels of nuoA2 and other respiratory components vary with the potential of the electrode:

  • At high potentials (>0 mV vs. SHE), the ImcH-dependent pathway predominates

  • At low potentials, the CbcL-dependent pathway is more important

  • NuoA2 expression may be regulated in concert with these components to optimize energy conservation

Syntrophic growth:
During syntrophic growth with denitrifying bacteria, as observed in mixed communities, G. sulfurreducens modifies its electron transport chain to facilitate interspecies electron transfer:

  • NuoA2 and other components of central metabolism remain critical for initial electron generation

  • Periplasmic cytochromes and conductive pili become upregulated

  • Expression patterns shift to favor nirS-dependent pathways

A complex regulatory network coordinates these components, with expression levels adjusted according to the redox potential of the terminal electron acceptor. This metabolic flexibility allows G. sulfurreducens to thrive in diverse environments and participate in various biogeochemical processes, including denitrification when growing syntrophically with other bacteria .

How does the function of nuoA2 contribute to the unique cell composition observed in G. sulfurreducens?

The function of nuoA2 as part of the NADH dehydrogenase complex plays a significant role in shaping the unique cellular composition of G. sulfurreducens, particularly in relation to its energy metabolism and electron transfer capabilities:

Contribution to unusual carbon:oxygen ratios:
Metabolomic studies have revealed that G. sulfurreducens exhibits high C:O and H:O ratios (approximately 1.7:1 and 0.25:1 respectively), indicating a more reduced cellular composition consistent with high lipid content . The NADH dehydrogenase complex containing nuoA2 impacts this composition by:

  • Influencing carbon flux through central metabolism

  • Affecting the redox state of the cell

  • Modulating the need for lipid biosynthesis to accommodate extensive membrane-bound electron transport complexes

Integration with cytochrome network:
G. sulfurreducens contains an extensive network of 111 predicted c-type cytochromes , requiring substantial energy investment in heme biosynthesis. The NADH dehydrogenase complex:

  • Provides reducing equivalents needed for heme biosynthesis

  • Generates proton motive force for energy-intensive cytochrome maturation

  • Coordinates with cytochrome expression to maintain optimal electron transfer

Adaptation to environmental conditions:
The nuoA2-containing complex contributes to the cell's ability to switch between different electron acceptors, which affects:

This relationship is bidirectional – the function of nuoA2 shapes cellular composition, while the unique membrane and protein composition of G. sulfurreducens creates the environment in which nuoA2 must function effectively. This metabolic specialization has enabled G. sulfurreducens to occupy a distinct ecological niche as an electrogenic organism capable of reducing metals and participating in global iron cycling .

What role might nuoA2 play in G. sulfurreducens' response to oxidative stress, and how can this be experimentally verified?

Despite being traditionally classified as a strict anaerobe, G. sulfurreducens demonstrates significant tolerance to oxygen exposure and possesses mechanisms to handle oxidative stress. The nuoA2 subunit may play both direct and indirect roles in this response:

Potential roles of nuoA2 in oxidative stress response:

  • Electron diversion mechanism

    • May participate in redirecting electron flow under oxidative conditions

    • Could help maintain redox balance when oxygen is present

    • May influence the activity of oxidative stress response proteins

  • Membrane integrity preservation

    • As a membrane protein, may contribute to membrane stability under oxidative stress

    • Could influence lipid composition adjustments in response to oxidative damage

  • Interaction with oxygen-responsive pathways

    • May functionally connect with proteins specifically induced under oxygen exposure

    • Could play a role in the microaerobic respiratory capability of G. sulfurreducens

Experimental verification methodologies:

Experimental ApproachMethodologyExpected Outcomes
Transcriptomic analysisRNA-Seq comparison of wild-type vs. nuoA2 deletion mutant under varying oxygen concentrationsIdentification of differentially expressed genes in oxidative stress pathways
Biochemical assaysMeasurement of ROS production and scavenging enzyme activities in nuoA2 mutantsQuantification of changes in oxidative stress handling capability
Protein-protein interaction studiesCo-immunoprecipitation or bacterial two-hybrid assaysIdentification of interactions between nuoA2 and known oxidative stress response proteins
Membrane composition analysisLipidomics of wild-type vs. nuoA2 mutant under oxidative stressDetection of alterations in membrane lipid composition and oxidation markers
Respiratory activity measurementsOxygen consumption rates in wild-type vs. nuoA2 mutantAssessment of microaerobic respiratory capability differences

Recent research has shown that G. sulfurreducens can tolerate oxygen exposure up to 24 hours and can utilize oxygen as an electron acceptor under microaerobic conditions (10% v/v oxygen) . The genome encodes several proteins involved in oxidative stress protection, including superoxide dismutase, cytochrome c peroxidase, catalase, peroxiredoxins, and rubrerythrins . Understanding how nuoA2 interfaces with these systems would provide valuable insights into the complex respiratory versatility of this organism.

How does the function of nuoA2 in G. sulfurreducens compare to similar subunits in other electrogenic bacteria, and what are the implications for extracellular electron transfer mechanisms?

Comparative analysis of nuoA2 across electrogenic bacteria reveals important evolutionary adaptations and functional specializations:

Structural and functional comparison:

OrganismNADH Dehydrogenase SubunitKey Distinguishing FeaturesRole in Extracellular Electron Transfer
G. sulfurreducensnuoA2 (GSU3445)Redundant copy; specialized membrane topologyCentral to redox loop with menaquinone pool; interfaces with ImcH pathway
Shewanella oneidensisNqrAPart of Na⁺-translocating NADH-quinone oxidoreductaseContributes to Na⁺ gradient rather than H⁺ gradient; different energy conservation mechanism
Rhodopseudomonas palustrisnuoASingle copy; less specializedPrimarily supports photosynthetic and fermentative metabolism
Desulfovibrio speciesNqo1/nuoAContains additional Fe-S clustersLinks to sulfate reduction pathways; different terminal electron acceptors

Implications for extracellular electron transfer:

  • Metabolic specialization
    The presence of a secondary nuoA2 in G. sulfurreducens suggests evolutionary adaptation for greater metabolic flexibility, particularly for extracellular electron transfer under varying redox conditions. This is consistent with Geobacter's ability to use various terminal electron acceptors ranging from soluble Fe(III) to solid electrodes .

  • Energy conservation differences
    The specific configuration of nuoA2 in relation to other respiratory components indicates that G. sulfurreducens has optimized its electron transport chain for efficient energy conservation during metal reduction. Unlike Shewanella, which utilizes flavin shuttles for extracellular electron transfer, Geobacter relies more heavily on direct contact through cytochromes and conductive pili .

  • Syntrophic capabilities
    The nuoA2-containing complex may contribute to G. sulfurreducens' remarkable ability to form syntrophic relationships with other organisms, such as denitrifying bacteria. This enables the formation of stable microbial communities with enhanced metabolic capabilities, as demonstrated in studies where syntrophic growth with denitrifying microbial communities accelerated denitrification rates by 13-51% .

Understanding these comparative differences is crucial for developing accurate models of extracellular electron transfer and for biotechnological applications involving electrogenic bacteria. The specific adaptations in nuoA2 and related complexes may explain why Geobacter species often dominate in certain bioelectrochemical systems and environmental settings .

What analytical techniques can researchers employ to study the interaction between nuoA2 and other components of the electron transport chain in G. sulfurreducens?

Researchers can employ a diverse array of analytical techniques to characterize the interactions between nuoA2 and other components of the electron transport chain in G. sulfurreducens:

Structural determination techniques:

  • Cryo-electron microscopy (Cryo-EM)

    • Application: Visualization of the entire NADH dehydrogenase complex containing nuoA2

    • Methodology: Purify intact complex in detergent micelles or nanodiscs; collect images at various angles; reconstruct 3D structure

    • Advantage: Preserves native conformation; can resolve structures at near-atomic resolution

  • X-ray crystallography

    • Application: High-resolution structure determination of nuoA2 and its binding interfaces

    • Methodology: Crystallize purified protein; collect diffraction patterns; solve phase problem; build atomic model

    • Challenge: Membrane proteins are notoriously difficult to crystallize

  • NMR spectroscopy

    • Application: Study of dynamic interactions and conformational changes

    • Methodology: Isotopically label protein (¹³C, ¹⁵N); acquire multidimensional spectra; analyze chemical shifts

    • Limitation: Size constraints may necessitate studying specific domains rather than full complex

Interaction mapping techniques:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Application: Identification of protein-protein interaction surfaces

    • Methodology: Expose protein complex to D₂O; monitor deuterium incorporation rates; identify protected regions

    • Advantage: Works with large membrane protein complexes

  • Chemical cross-linking coupled with mass spectrometry (XL-MS)

    • Application: Determination of proximity relationships between proteins

    • Methodology: Treat complex with bifunctional cross-linkers; digest proteins; identify cross-linked peptides by MS/MS

    • Insight: Provides distance constraints between interacting partners

  • Förster resonance energy transfer (FRET)

    • Application: Real-time monitoring of protein interactions in living cells

    • Methodology: Generate fluorescent protein fusions; measure energy transfer efficiency

    • Advantage: Can detect transient interactions under physiological conditions

Functional assays:

  • Electrophysiological measurements

    • Application: Assessment of electron transfer rates and membrane potential generation

    • Methodology: Reconstitute components into proteoliposomes; measure currents using patch-clamp or solid-supported membrane techniques

    • Insight: Directly measures functional output of the complex

  • Redox potentiometry

    • Application: Determination of midpoint potentials for electron transfer components

    • Methodology: Titrate with reductants/oxidants; monitor spectral changes

    • Relevance: Establishes thermodynamic feasibility of electron transfer pathways

These techniques, when applied in combination, provide a comprehensive understanding of how nuoA2 integrates into the electron transport network of G. sulfurreducens. Similar approaches have yielded valuable insights into the function of other components such as ImcH and cytochromes of the PpcA family, revealing their roles in extracellular electron transfer pathways .

What genetic manipulation strategies could be used to study the role of nuoA2 in the metabolic versatility of G. sulfurreducens?

Several sophisticated genetic manipulation strategies can be employed to elucidate the role of nuoA2 in G. sulfurreducens metabolism:

CRISPR-Cas9 based genome editing

  • Methodology: Design sgRNAs targeting nuoA2; transform cells with CRISPR-Cas9 and homology-directed repair templates

  • Applications:

    • Create precise point mutations in functional domains

    • Generate markerless deletions

    • Introduce reporter fusions at the native locus

  • Advantage: Minimizes polar effects on adjacent genes

  • Implementation note: While traditional methods using antibiotic markers have been established , CRISPR systems optimized for anaerobic conditions would increase efficiency

Conditional expression systems

  • Methodology: Replace native promoter with regulatable promoters (tetracycline-responsive or riboswitch-based)

  • Applications:

    • Tune expression levels to determine minimal functional thresholds

    • Study effects of temporal expression patterns

    • Create depletion strains for essential functions

  • Key experiment: Correlate nuoA2 expression levels with electron transfer rates to different acceptors

Domain swapping and chimeric proteins

  • Methodology: Create fusion constructs replacing domains of nuoA2 with homologous regions from other bacteria

  • Applications:

    • Identify species-specific adaptations

    • Map functional domains critical for Geobacter-specific metabolism

    • Engineer variants with enhanced properties

  • Specific approach: Exchange domains between nuoA2 and nuoA1 to determine specificity

Complementation analysis

  • Methodology: Express nuoA2 variants in knockout strains under control of native or constitutive promoters

  • Applications:

    • Rescue mutant phenotypes to confirm function

    • Test heterologous genes for functional conservation

    • Validate structure-function hypotheses

  • Control considerations: Include proper controls for expression levels and protein stability

Multi-omics integration

  • Methodology: Combine transcriptomics, proteomics, and metabolomics analyses of nuoA2 mutants

  • Applications:

    • Map global effects of nuoA2 manipulation

    • Identify compensatory pathways

    • Discover unexpected regulatory connections

  • Data analysis: Apply machine learning approaches to identify non-obvious correlations

These genetic strategies could reveal how nuoA2 contributes to G. sulfurreducens' ability to adapt to different electron acceptors and growth conditions. Similar approaches have successfully elucidated the roles of other components in the extracellular electron transfer pathway, such as the PilT motor in type IV pili function and cytochromes involved in Pd(II) reduction .

How might understanding the structure and function of nuoA2 contribute to biotechnological applications of G. sulfurreducens in bioremediation and bioelectricity generation?

Understanding the structure and function of nuoA2 could significantly advance biotechnological applications of G. sulfurreducens through several mechanisms:

Enhancing bioelectricity generation:

The NADH dehydrogenase complex containing nuoA2 represents a critical junction in electron flow from central metabolism to extracellular electron transfer chains. Detailed knowledge of this component could enable:

  • Engineered strains with improved electron transfer efficiency

    • Targeted modifications to optimize proton pumping-to-electron transfer ratios

    • Enhanced coupling between acetate oxidation and current production

    • Reduced metabolic bottlenecks in the electron transport chain

  • Design of optimized bioelectrochemical systems

    • Development of electrode materials that interface specifically with the nuoA2-dependent pathway

    • Creation of artificial electron acceptors that can intercept electrons at the optimal redox potential

    • Engineering of biofilm architectures that maximize extracellular electron transfer

Advancing bioremediation capabilities:

G. sulfurreducens has demonstrated ability to reduce various metals and contaminants, with nuoA2 potentially playing a key role in:

  • Expanding the range of reducible contaminants

    • Engineering variants with altered redox properties to target recalcitrant pollutants

    • Creating strains with enhanced tolerance to toxic compounds

    • Developing systems for simultaneous removal of multiple contaminant types

  • Improving remediation efficiency

    • Optimizing electron flux through nuoA2-dependent pathways to increase metal reduction rates

    • Engineering strains with enhanced syntrophic capabilities for mixed-culture bioremediation

    • Developing biosensors based on nuoA2 activity to monitor remediation progress

Practical implementation strategies:

  • Genetic optimization approaches

    • Site-directed mutagenesis of nuoA2 to enhance activity or alter substrate specificity

    • Adjusting expression levels to maximize electron transfer without compromising cellular viability

    • Creating regulated systems that can adapt to changing environmental conditions

  • Integration with existing technologies

    • Combining engineered G. sulfurreducens strains with conventional treatment systems

    • Developing immobilization matrices that preserve nuoA2 function while protecting cells

    • Creating standardized modules for deployment in various environmental contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.