Recombinant Geobacter sulfurreducens NADH-quinone oxidoreductase subunit K 1 (nuoK1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoK1; GSU0348; NADH-quinone oxidoreductase subunit K 1; NADH dehydrogenase I subunit K 1; NDH-1 subunit K 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Target Names
nuoK1
Target Protein Sequence
MVSLHSYLIVSAILFSIGTIGVLVRRNAIVIFMCVEMMLNAVNLTFIALSRHLGNIDGQI FVFFVMTVAAAEAAVGLALMIAFYKNRESIDVEDVKLMKL
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is the presumed immediate electron acceptor. The enzyme couples this redox reaction to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, conserving redox energy within a proton gradient.
Database Links

KEGG: gsu:GSU0348

STRING: 243231.GSU0348

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of NADH-quinone oxidoreductase subunit K 1 in Geobacter sulfurreducens?

NADH-quinone oxidoreductase subunit K 1 (nuoK1) functions as an integral membrane component of Complex I in the electron transport chain of G. sulfurreducens. While structurally similar to the nuoK1 in G. bemidjiensis, the G. sulfurreducens variant plays a critical role in electron transfer mechanisms, particularly in relation to extracellular electron transport that makes this microorganism valuable for bioelectrochemical applications . The protein contributes to proton translocation across the membrane during the transfer of electrons from NADH to quinone, helping to establish the proton gradient necessary for ATP synthesis.

What experimental designs are most appropriate for studying nuoK1 function in vivo?

When designing experiments to study nuoK1 function in vivo, researchers should consider implementing true experimental designs that control for threats to internal validity. Based on established experimental methodology, the pretest-posttest control group design provides the strongest framework, with random assignment to experimental and control groups and measurements taken before and after intervention .

The following experimental design table outlines appropriate approaches for nuoK1 research:

Design TypeDescriptionStrengthsLimitationsApplication to nuoK1 Research
Pretest-Posttest Control GroupRandom assignment with measurements before and after interventionControls for most threats to internal validityRequires larger sample sizeComparing wild-type vs. nuoK1 mutant phenotypes
Solomon Four-Group DesignCombines pretest-posttest with additional groups receiving only pretest or posttestControls for testing effectsComplex implementationComprehensive evaluation of nuoK1 genetic modifications
Posttest-Only Control GroupRandom assignment with measurement only after interventionEliminates testing effectsCannot control for baseline differencesScreening multiple nuoK1 variants

Researchers must be particularly attentive to history, maturation, testing, and instrumentation threats to internal validity when studying nuoK1, as these factors can confound the interpretation of observed phenotypes .

How can researchers effectively apply homologous recombination techniques to study nuoK1?

Homologous recombination provides a powerful approach for nuoK1 gene modification in G. sulfurreducens. To optimize this methodology, researchers should implement the reference-query pyrosequencing (RQPS) method to accurately identify successful recombinants . This technique is particularly valuable when working with bacterial genes where traditional screening approaches may be challenging.

The implementation involves:

  • Designing targeting vectors with appropriate homology arms (typically 500-1500bp)

  • Incorporating SNVs (Single Nucleotide Variants) into the targeting vector to facilitate screening

  • Using pyrosequencing to identify successful recombination events

A key advantage of the RQPS method is the ability to accurately determine copy number of the modified gene, ensuring that experimental phenotypes result from specific genetic modifications rather than off-target effects or multiple integration events . When introducing the SNVs into the targeting vector, researchers should position one SNV approximately 50bp from the payload and another in the selection cassette to enable enrichment for homologous recombinants through pyroscreening .

What methodological considerations are important when expressing recombinant nuoK1 for structural and functional studies?

Expression of membrane proteins like nuoK1 presents significant challenges that require methodological optimization. Researchers should consider:

  • Expression System Selection: While E. coli systems are accessible, insect cell expression systems often yield better results for membrane proteins from G. sulfurreducens.

  • Induction Conditions: Lower temperatures (16-20°C) and reduced inducer concentrations minimize toxicity and inclusion body formation.

  • Fusion Partners: Addition of solubility-enhancing tags (MBP, SUMO) while maintaining C-terminal affinity tags for purification.

  • Detergent Screening: Systematic evaluation of detergents for solubilization, with milder detergents (DDM, LMNG) often preserving structure and function.

  • Stability Assessment: Implementing thermal shift assays to identify buffer conditions that enhance protein stability.

When designing expression constructs, researchers should consider the entire operon context, as nuoK1 may require co-expression with partner subunits for proper folding and stability. Verification of expressed protein functionality through activity assays is essential before proceeding to structural or interaction studies.

How can the reference-query pyrosequencing (RQPS) method be adapted for nuoK1 copy number determination?

The RQPS method provides a precise approach for determining nuoK1 copy number in engineered strains. Implementation requires:

  • Creating a composite probe containing two fused DNA fragments:

    • A reference fragment from a gene with known copy number

    • A query fragment from the nuoK1 gene

  • Introducing artificial SNVs into both fragments to differentiate from wild-type alleles

  • Preparing DNA mixtures with different probe-to-genomic DNA ratios

  • Performing quantitative pyrosequencing to determine SNV ratios

  • Calculating copy number using the formula t = 2k, where k is the slope derived from plotting m/(1-m) against n/(1-n) values

This methodology provides several advantages over traditional methods, including independence from duplication breakpoint knowledge and the ability to accurately determine copy number regardless of integration site . For G. sulfurreducens research, this approach enables verification of single-copy integration events, which is critical for attributing phenotypes specifically to nuoK1 modifications rather than dosage effects.

What statistical approaches are most appropriate for analyzing nuoK1 mutation effects on electron transport?

Statistical analysis of nuoK1 mutation effects requires careful consideration of experimental design and data characteristics. The following approaches are recommended:

Statistical ApproachAppropriate Use CaseRequired AssumptionsAdvantages
Mixed-effects modelsComplex designs with multiple factorsVarious depending on modelHandles missing data, accounts for random effects
Repeated measures ANOVATime-course experimentsSphericity, normalityAccounts for time-dependent correlation
Multiple testing correctionScreening multiple nuoK1 variantsDepends on specific methodControls false discovery rate
Non-parametric testsWhen normality assumptions are violatedFewer than parametric testsRobust to outliers and non-normal data

When implementing these approaches, researchers should be mindful of statistical regression effects, particularly when working with extreme responders. As noted in experimental design literature, groups selected based on extreme scores may show changes due to regression toward the mean rather than treatment effects . For nuoK1 research, this is particularly relevant when screening mutants with extreme phenotypes.

How can researchers differentiate between direct effects of nuoK1 mutations and compensatory responses?

Differentiating primary effects from compensatory responses represents a significant challenge in nuoK1 research. Methodological approaches to address this include:

  • Time-resolved experiments: Implementing experimental designs that capture immediate effects (minutes to hours) separately from longer-term responses (days).

  • Inducible expression systems: Using tightly controlled promoters to observe immediate consequences of nuoK1 variant expression.

  • Multi-omics integration: Combining transcriptomic, proteomic, and metabolomic data to identify cascades of cellular responses following nuoK1 mutation.

  • In vitro reconstitution: Isolating the NADH-quinone oxidoreductase complex with wild-type or mutant nuoK1 for activity assays in a defined system.

These approaches help researchers address the "history" and "maturation" threats to internal validity described in experimental design literature , where observed effects might be confounded by other processes occurring between measurements. By implementing robust experimental designs with appropriate controls, researchers can more confidently attribute observed phenotypes directly to nuoK1 modifications.

What approaches help address data inconsistency when measuring electron transport activity in nuoK1 mutants?

Data inconsistency in electron transport measurements can be addressed through:

  • Standardization of growth conditions: Controlling cell density, growth phase, and media composition precisely.

  • Multiple measurement techniques: Employing complementary methods (oxygen consumption, membrane potential measurements, direct electrochemistry) to provide convergent evidence.

  • Statistical regression analysis: Recognizing that extreme responders may show regression effects unrelated to experimental manipulation .

  • Instrumentation calibration: Regular calibration to minimize the "instrumentation" threat to internal validity .

  • Single-cell techniques: Implementing methods that capture population heterogeneity rather than relying solely on bulk measurements.

What are effective approaches for studying protein-protein interactions involving nuoK1?

Studying protein-protein interactions of membrane proteins like nuoK1 requires specialized techniques:

  • Chemical cross-linking coupled with mass spectrometry (XL-MS): This approach captures spatial relationships by covalently linking proteins in close proximity before complex isolation and identification.

  • Co-immunoprecipitation with epitope-tagged nuoK1: Using affinity purification with mild detergents that preserve complex integrity.

  • Bacterial two-hybrid systems: Modified for membrane proteins to verify specific interactions.

  • Structural biology approaches: Cryo-electron microscopy of the intact complex can reveal the position and interactions of nuoK1 at near-atomic resolution.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifying regions of nuoK1 involved in subunit interactions through differential solvent accessibility.

The integration of multiple complementary techniques provides the most comprehensive characterization of nuoK1's interaction network within the NADH-quinone oxidoreductase complex and potentially with other cellular components.

How might comparative genomics of nuoK1 across Geobacter species inform functional studies?

Comparative genomics provides valuable insights for functional characterization of nuoK1 through:

  • Sequence conservation analysis: Identifying highly conserved residues that likely have functional importance.

  • Clade-specific variation analysis: Correlating sequence differences with known phenotypic variations in electron transfer capabilities.

  • Co-evolution analysis: Detecting residues showing correlated evolutionary patterns, which may indicate interaction networks.

  • Positive selection analysis: Identifying residues under selective pressure that may contribute to environmental adaptation.

This comparative approach can guide the design of targeted mutagenesis experiments, focusing on residues most likely to have functional significance based on evolutionary conservation patterns. When combined with structural modeling, these insights can inform protein engineering efforts aimed at enhancing electron transfer capabilities for biotechnological applications.

What methodological advances are needed to better understand nuoK1 kinetics in vivo?

Current methodological limitations constrain our understanding of nuoK1 kinetics in living cells. Key advances needed include:

  • Improved temporal resolution in redox sensors: Developing probes capable of capturing millisecond-scale electron transfer events.

  • Site-specific incorporation of spectroscopic probes: Expanding genetic tools to incorporate unnatural amino acids with unique spectroscopic properties at specific sites in nuoK1.

  • Single-molecule tracking in native membranes: Technologies for visualizing individual protein complexes in their native environment.

  • Advanced in situ structural methods: Improved cryo-electron tomography to capture conformational states during electron transport.

  • Nanoscale electrochemistry: Developing methods to position electrochemical probes with nanometer precision near the cell surface.

These methodological advances would address current limitations in understanding the rapid dynamics of electron transfer through nuoK1 and its relationship to extracellular electron transfer capabilities that make G. sulfurreducens valuable for bioelectrochemical applications.

What emerging approaches show promise for studying nuoK1's role in extracellular electron transfer?

Emerging approaches that show particular promise include:

  • Bioelectrochemical systems: Three-electrode configurations allowing real-time measurement of electron transfer rates under controlled potentials.

  • Atomic force microscopy with conductive probes: Measuring conductivity at the single-cell level to examine how nuoK1 variants affect electron transfer across the cell surface.

  • Redox-sensitive fluorescent proteins: Genetically encoded sensors visualizing changes in redox states related to nuoK1 function.

  • Correlative microscopy: Relating fluorescently tagged nuoK1 localization to ultrastructural features involved in electron transfer.

  • Metabolic flux analysis: Using isotope labeling to trace electron flow through different pathways in nuoK1 variants.

These approaches address the complex relationship between internal electron transport chains and the extracellular electron transfer capabilities that distinguish Geobacter species in bioelectrochemical applications.

How can pyrosequencing methods be optimized for nuoK1 research in Geobacter species?

The reference-query pyrosequencing (RQPS) method can be optimized for nuoK1 research through:

  • Careful selection of reference genes: Identifying G. sulfurreducens genes with stable copy numbers across experimental conditions.

  • Optimization of SNV positions: Designing SNVs that maximize pyrosequencing signal quality while maintaining distinct detection.

  • Integration with homologous recombination techniques: Using the "pyroscreening" approach to enrich for homologous recombinants by examining the ratio of SNVs .

  • Adaptation for multiple query sites: Expanding the method to simultaneously analyze multiple regions of nuoK1 or related genes.

These optimizations can enhance the efficiency of identifying and characterizing genetic modifications to nuoK1, supporting more comprehensive functional studies of this important protein in electron transfer processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.