Recombinant Geobacter sulfurreducens NADH-quinone oxidoreductase subunit K 2 (nuoK2)

Shipped with Ice Packs
In Stock

Description

Electron Transport and Energy Conservation

In G. sulfurreducens, Complex I is critical for energy production during acetate oxidation or hydrogen/formate utilization. Electrons from NADH are relayed through Complex I to the menaquinone pool, which fuels extracellular electron transfer (EET) to insoluble minerals or electrodes . While nuoK2’s direct role in EET remains unstudied, mutations in related subunits (e.g., nuoH) disrupt proton pumping and impair growth under electrode-respiring conditions .

Regulatory and Metabolic Context

  • Transcriptional Regulation: G. sulfurreducens employs operon organization and regulatory proteins (e.g., IclR-family regulators) to modulate Complex I expression under varying electron donor/acceptor conditions .

  • Metabolic Flexibility: The organism couples Complex I activity to chemolithoautotrophic growth (e.g., using CO₂ fixation pathways) when supplied with H₂ or formate .

Recombinant Production and Applications

Recombinant nuoK2 is synthesized in heterologous hosts (e.g., E. coli or mammalian cells) for structural and functional studies . Limited supplier data indicates:

SupplierSource OrganismPurityTag InfoApplication
CUSABIO TECHNOLOGY LLC Geobacter sulfurreducens>85% (SDS-PAGE)UndisclosedResearch (e.g., protein interaction studies)
CUSABIO TECHNOLOGY LLC Geobacter bemidjiensis>85% (SDS-PAGE)UndisclosedComparative structural biology

Challenges and Future Directions

  1. Structural Elucidation: High-resolution crystallography or cryo-EM of G. sulfurreducens Complex I is needed to resolve nuoK2’s interactions with other subunits.

  2. Functional Redundancy: Overlapping roles of Complex I with other quinone oxidoreductases (e.g., ImcH, CbcL) in EET require genetic knockout studies .

  3. Biotechnological Potential: Engineering nuoK2 variants could enhance proton pumping efficiency in bioelectrochemical systems .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All protein shipments are sent with standard blue ice packs. For dry ice shipment, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%. You can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is defined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
nuoK2; GSU3432; NADH-quinone oxidoreductase subunit K 2; NADH dehydrogenase I subunit K 2; NDH-1 subunit K 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Target Names
nuoK2
Target Protein Sequence
MIVPFEHVLILAGLLFALGLVCVLVWRMNLIMLLIGIEVMLNAAMLAFVGGAARWGMADG QVFSLIIMALTSAEVSLALAMVVYLHRRKKTVDADEFRELQG
Uniprot No.

Target Background

Function
NDH-1 functions as an electron shuttle, transporting electrons from NADH to quinones within the respiratory chain. This process involves FMN and iron-sulfur (Fe-S) centers. In this particular species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples this redox reaction with proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This mechanism effectively conserves redox energy in a proton gradient.
Database Links

KEGG: gsu:GSU3432

STRING: 243231.GSU3432

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Geobacter sulfurreducens NADH-quinone oxidoreductase subunit K 2 (nuoK2)?

Recombinant Geobacter sulfurreducens NADH-quinone oxidoreductase subunit K 2 (nuoK2) is a protein component of the NADH-quinone oxidoreductase complex found in the bacterium Geobacter sulfurreducens. This protein plays a critical role in electron transfer processes, specifically in the transfer of electrons from NADH to quinones, which is essential for cellular respiration and energy production in this microorganism. The recombinant form refers to the protein that has been produced using genetic engineering techniques rather than isolated directly from the native organism .

How does the structure of nuoK2 compare to other quinone oxidoreductases?

The structure of nuoK2 from Geobacter sulfurreducens likely shares common structural elements with other quinone oxidoreductases, such as those found in Phytophthora capsici and Saccharomyces cerevisiae. Similar enzymes typically exhibit a bi-modular architecture, containing a NADPH-binding groove and a substrate-binding pocket in each subunit. For instance, the NADPH-dependent QOR from P. capsici features these structural elements, which are critical for its function .

The NADH-binding domain typically adopts a Rossmann fold, which is a common structural motif in nucleotide-binding proteins. This structure provides a platform for NADPH binding, while the substrate-binding domain often contains a hydrophobic pocket connected to the NADPH-binding site, which appears to play important roles in substrate binding and specificity .

What experimental techniques are commonly used to study nuoK2 structure?

Researchers typically employ several complementary techniques to elucidate the structure of proteins like nuoK2:

  • X-ray crystallography: This technique provides high-resolution structural information and has been successfully used to determine the crystal structures of related quinone oxidoreductases. For example, the crystal structure of NADPH-dependent QOR from P. capsici was determined at 2.4 Å resolution using this method .

  • Gel filtration and ultracentrifugation: These techniques help determine the oligomeric state of the protein in solution. Similar quinone oxidoreductases have been found to function as tetramers in solution .

  • Computational methods: Homology modeling can be used to predict the structure of nuoK2 based on the known structures of related proteins, especially when experimental determination is challenging.

  • Site-directed mutagenesis: This technique, coupled with activity assays, helps identify key residues involved in substrate binding and catalysis .

How can I optimize the expression and purification of recombinant nuoK2?

Optimizing expression and purification of recombinant nuoK2 requires a methodical approach:

  • Expression system selection: Choose an appropriate expression system based on the properties of nuoK2. E. coli is commonly used for bacterial proteins, but for proteins requiring post-translational modifications, eukaryotic systems may be preferable.

  • Vector design: Include appropriate promoters, fusion tags (His-tag, GST, etc.) for easier purification, and codon optimization for the expression host.

  • Expression optimization:

    • Test multiple expression conditions (temperature, IPTG concentration, induction time)

    • Evaluate different E. coli strains

    • Consider using specialized strains for proteins containing rare codons

  • Purification strategy:

    • Begin with affinity chromatography based on fusion tags

    • Follow with size exclusion chromatography to remove aggregates and achieve higher purity

    • Consider ion exchange chromatography for further purification

  • Protein quality assessment:

    • SDS-PAGE for purity

    • Mass spectrometry for identity confirmation

    • Activity assays to ensure functional integrity

What are the key considerations for designing enzyme activity assays for nuoK2?

When designing enzyme activity assays for nuoK2, researchers should consider:

  • Substrate selection: Based on related quinone oxidoreductases, choose appropriate quinone substrates. These enzymes often show preferences for certain quinone structures. For example, some quinone oxidoreductases preferentially catalyze larger substrates like 9,10-phenanthrenequinone .

  • Cofactor requirements: Ensure appropriate concentrations of NADH or NADPH, as these are essential cofactors for the reaction. The choice between NADH and NADPH is crucial as some enzymes show strong preference for one over the other .

  • Reaction conditions:

    • pH optimization (typically pH 6.5-8.0 for most oxidoreductases)

    • Temperature optimization (typically 25-37°C)

    • Buffer composition

    • Ionic strength

  • Detection methods:

    • Spectrophotometric monitoring of NADH/NADPH oxidation at 340 nm

    • Measurement of quinone reduction using appropriate wavelengths

    • Coupled enzyme assays for more sensitive detection

  • Control reactions:

    • No-enzyme controls

    • Heat-inactivated enzyme controls

    • Alternative substrate controls

How can structural information guide site-directed mutagenesis studies of nuoK2?

Structural information provides valuable guidance for site-directed mutagenesis studies of nuoK2:

  • Identify conserved residues: Alignment of homologous structures reveals conserved residues likely crucial for enzyme function. These are primary targets for mutagenesis studies .

  • Map the active site: Based on structural data of related enzymes, identify residues that form the quinone-binding channel and NADH-binding site. For example, in related quinone oxidoreductases, specific residues have been identified as critical for substrate binding and catalysis through computational simulation and site-directed mutagenesis .

  • Target interface residues: For oligomeric enzymes, residues at subunit interfaces can be mutated to understand the importance of oligomerization for enzyme function.

  • Design rational mutations:

    • Conservative substitutions to assess the importance of specific chemical properties

    • Charge reversal to test electrostatic interactions

    • Alanine scanning to identify essential residues

  • Analyze mutation effects:

    • Kinetic parameters (Km, kcat, substrate specificity)

    • Stability (thermal denaturation, protease sensitivity)

    • Oligomerization state

What is the optimal design of experiments (DOE) approach for studying nuoK2 functional parameters?

A robust DOE approach for studying nuoK2 functional parameters would include:

  • Factor identification: Identify key factors affecting enzyme function such as pH, temperature, substrate concentration, cofactor concentration, and ionic strength .

  • Response selection: Choose appropriate responses to measure, such as:

    • Initial reaction velocity

    • Substrate conversion efficiency

    • Product yield

    • Enzyme stability

  • Experimental design selection:

    • Factorial designs: To assess multiple factors and their interactions

    • Response surface methodology: To optimize reaction conditions

    • Plackett-Burman designs: For screening many factors with fewer experiments

  • Statistical analysis plan:

    • ANOVA to evaluate significance of factors

    • Regression analysis to develop predictive models

    • Residual analysis to validate model assumptions

  • Validation experiments:

    • Confirmation runs at optimized conditions

    • Repeatability assessment

    • Robustness testing

This approach aligns with the principles of experimental design that aim to describe and explain variation under hypothesized conditions, ensuring validity, reliability, and replicability of results .

How should researchers approach analyzing structure-function relationships in nuoK2?

Analysis of structure-function relationships in nuoK2 requires a multi-faceted approach:

What data analysis approaches are recommended for nuoK2 characterization experiments?

For comprehensive characterization of nuoK2, researchers should employ various data analysis approaches:

  • Kinetic data analysis:

    • Non-linear regression for determining kinetic parameters (Km, Vmax, kcat)

    • Evaluation of different kinetic models (Michaelis-Menten, Hill, etc.)

    • Global fitting of multiple datasets for complex mechanisms

    • Statistical comparison of parameters across different conditions

  • Structural data analysis:

    • Crystallographic data refinement and validation

    • Electron density map interpretation

    • B-factor analysis for flexibility assessment

    • Structural superposition with homologous proteins

  • Qualitative data analysis for mechanistic studies:

    • Systematic coding of experimental observations using software like NVivo

    • Identification of patterns and development of themes from multiple experiments

    • Integration of findings into a coherent mechanistic model

  • Visualization and modeling:

    • 3D structural visualization to identify key interactions

    • Molecular dynamics simulations to assess dynamic behavior

    • Docking studies to predict substrate binding modes

  • Integrated data analysis:

    • Correlation of structural features with kinetic parameters

    • Machine learning approaches for identifying structure-function patterns

    • Network analysis for understanding protein-protein interactions

What are common challenges in purifying active nuoK2 and how can they be addressed?

Researchers often encounter several challenges when purifying active nuoK2:

  • Protein solubility issues:

    • Challenge: Formation of inclusion bodies

    • Solution: Lower expression temperature (16-20°C), use solubility-enhancing fusion tags (SUMO, MBP), add solubility enhancers (sorbitol, glycerol) to growth media

  • Enzyme instability:

    • Challenge: Loss of activity during purification

    • Solution: Include stabilizing agents (glycerol, reducing agents), maintain cold temperature throughout purification, minimize time between steps

  • Low yield:

    • Challenge: Insufficient protein expression

    • Solution: Optimize codon usage, test different expression systems, use stronger promoters, optimize induction conditions

  • Contaminant proteins:

    • Challenge: Co-purification of host proteins

    • Solution: Implement multi-step purification strategy, use highly specific affinity tags, consider on-column refolding

  • Cofactor loss:

    • Challenge: Dissociation of essential cofactors during purification

    • Solution: Supplement buffers with required cofactors (NADH/NADPH), avoid harsh conditions that might disrupt cofactor binding

How can researchers address data inconsistencies in nuoK2 activity assays?

When facing data inconsistencies in nuoK2 activity assays, researchers should systematically address potential sources of variation:

  • Enzyme quality assessment:

    • Verify protein purity by SDS-PAGE and mass spectrometry

    • Check for potential inhibitors or activators in the preparation

    • Assess enzyme stability under assay conditions

  • Assay component standardization:

    • Use fresh, high-quality reagents

    • Standardize substrate preparation methods

    • Verify cofactor quality and concentration

    • Control temperature precisely during assays

  • Instrumentation checks:

    • Calibrate spectrophotometers and other instruments regularly

    • Use the same equipment for comparative assays

    • Include internal standards

  • Statistical approaches:

    • Increase the number of technical and biological replicates

    • Apply appropriate statistical tests to identify outliers

    • Use control charts to monitor assay performance over time

  • Systematic variation identification:

    • Design experiments to isolate sources of variation

    • Document all procedural details meticulously

    • Implement standard operating procedures

What are potential applications of nuoK2 in bioremediation research?

Considering the role of quinone oxidoreductases in electron transfer and detoxification processes, nuoK2 from Geobacter sulfurreducens presents several interesting applications in bioremediation:

  • Heavy metal remediation:

    • G. sulfurreducens is known for its ability to reduce metals

    • nuoK2 may play a role in electron transfer to metal oxides

    • Understanding nuoK2 function could lead to engineered strains with enhanced metal reduction capabilities

  • Degradation of organic pollutants:

    • Quinone oxidoreductases can participate in the reduction of quinone-containing compounds

    • nuoK2 might be involved in the detoxification of harmful chemicals similar to the role observed in P. capsici

    • Engineered nuoK2 variants could potentially target specific environmental contaminants

  • Bioelectrochemical systems:

    • G. sulfurreducens is important in microbial fuel cells

    • nuoK2's role in electron transfer makes it relevant for improving electron transfer to electrodes

    • Structural understanding could guide protein engineering for enhanced performance

  • Biosensor development:

    • nuoK2 activity could be harnessed to detect specific quinone-containing compounds

    • Structure-guided modifications could enhance specificity for target pollutants

  • Integration with other remediation approaches:

    • Combined enzymatic systems incorporating nuoK2 and complementary enzymes

    • Immobilized enzyme systems for continuous treatment processes

How might comparative analysis of nuoK2 with homologs from different organisms inform protein engineering efforts?

Comparative analysis of nuoK2 with homologs can provide valuable insights for protein engineering:

  • Identification of functional domains:

    • Comparison with well-characterized homologs like the NADPH-dependent QOR from P. capsici can help identify conserved functional domains

    • Variations in domain organization might suggest alternative approaches to engineering

  • Substrate specificity determinants:

    • Alignment of active site residues across homologs with different substrate preferences

    • Identification of residues that correlate with specificity for different quinones

    • For example, some quinone oxidoreductases show preference for larger substrates like 9,10-phenanthrenequinone, suggesting specific structural features that accommodate these substrates

  • Stability factors:

    • Comparison with homologs from extremophiles might reveal stability-enhancing features

    • Identification of conserved vs. variable regions to guide modifications without disrupting core function

  • Oligomerization interfaces:

    • Analysis of tetrameric interfaces in homologs like those observed in P. capsici QOR

    • Understanding the importance of oligomerization for function and stability

  • Cofactor preference:

    • Identification of residues determining NADH vs. NADPH specificity

    • Engineering altered cofactor preference based on homolog comparison

This comparative approach can guide rational design of nuoK2 variants with enhanced stability, altered substrate specificity, or optimized catalytic efficiency.

What methodological approaches are recommended for studying nuoK2 interactions with other protein subunits in the respiratory chain?

To study nuoK2 interactions with other protein subunits in the respiratory chain, researchers should consider multiple complementary approaches:

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation to identify interacting partners

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Yeast two-hybrid or bacterial two-hybrid screening for systematic interaction mapping

  • Structural studies of complexes:

    • Cryo-electron microscopy for large respiratory complexes

    • X-ray crystallography of sub-complexes

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to map binding surfaces

  • Functional validation:

    • Site-directed mutagenesis of predicted interface residues

    • Enzyme activity assays of reconstituted complexes

    • Electron transfer measurements between subunits

    • In vivo complementation studies with mutant variants

  • Computational analyses:

    • Molecular docking to predict interaction modes

    • Molecular dynamics simulations to assess stability of complexes

    • Sequence covariation analysis to identify co-evolving residues at interfaces

  • Visualization techniques:

    • Förster resonance energy transfer (FRET) to monitor interactions in real-time

    • Fluorescence microscopy with tagged proteins to observe co-localization

    • High-resolution microscopy techniques for in situ visualization

This multi-faceted approach provides robust evidence for specific interactions and their functional significance in the respiratory chain.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.