Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference when placing the order. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped standard with normal blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during the production process. If you require a specific tag type, please inform us. We will preferentially develop the specified tag.
Synonyms
lgt; GSU1425; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Protein Length
full length protein
Species
Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Target Protein Sequence
MQFPHIDPVFFRLGHLEFRWYGLMYILGFIAAYFIVRRAAGRRGLALTQDDVADVIFSLA
IGVILGGRLGYILFYNLSYYLSHPLKLFAVWEGGMSFHGGLLGVILAGVYVARQKKIGFP
VLADICAPAAPVGLGLGRLGNFINGELYGRVTDVPWGIIFPGGGGVPRHPSQLYEAVLEG
PVLFLILMAVGRRERPAGVVFWTFIAFYGLFRFLVEFFREPDAQLGLLAGPFSMGQLLSF
PMFLLGLTMAVLVSRRKVGP