Recombinant Geobacter sulfurreducens Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
crcB; GSU0503; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Target Names
crcB
Target Protein Sequence
MPAGCESNPRLVGHPFMTTILAIAVFGAVGCVARYLLAGGVYALAGRAFPWGTLAVNVIG AFLIGLIMEAALRTTLMSQELRLGLTIGFLGGFTTFSTFSYETFKLLEDGEFFSASLNVL ASVALCLVGTWAGIMAARQL
Uniprot No.

Target Background

Function
Plays a crucial role in reducing fluoride concentration within cells, mitigating its toxicity.
Database Links

KEGG: gsu:GSU0503

STRING: 243231.GSU0503

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Geobacter sulfurreducens and why is it significant in microbiological research?

Geobacter sulfurreducens is a metal-reducing bacterium belonging to the Geobacteraceae family. It is significant because it can oxidize organic compounds using Fe(III) oxide as the terminal electron acceptor . It serves as a model organism for studying extracellular electron transfer processes critical for bioelectricity generation and bioremediation applications . G. sulfurreducens has become increasingly important in environmental microbiology due to its ability to form electroactive biofilms and participate in various biogeochemical cycles.

What are the major proteins involved in extracellular electron transfer in G. sulfurreducens?

G. sulfurreducens employs several key protein systems for extracellular electron transfer:

  • Outer membrane c-type cytochromes: OmcB, OmcC, OmcS, OmcZ, and OmcE - these multiheme proteins facilitate electron transfer to external electron acceptors .

  • Porin-cytochrome (Pcc) protein complexes: These trans-outer membrane protein complexes consist of a porin-like protein (OmbB/OmbC), a periplasmic cytochrome (OmaB/OmaC), and an outer membrane cytochrome (OmcB/OmcC) .

  • Inner membrane proteins: CbcL, which contains b-type and multiheme c-type cytochrome domains, is essential for electron transfer to low-potential electron acceptors .

How is recombinant protein expression typically achieved for G. sulfurreducens proteins?

Recombinant proteins from G. sulfurreducens can be expressed in Escherichia coli using appropriate expression systems. For cytochromes, which require proper heme incorporation, co-expression with the cytochrome c maturation gene cluster (ccmABCDEFGH) is essential . When expressing these proteins:

  • Signal peptide modifications may be necessary

  • Expression tag placement is critical (C-terminal tags are often preferable)

  • Growth conditions must be optimized for proper heme incorporation

  • Expression yields of 4-6 mg/L can be achieved for proteins like cytochrome c7

It's important to note that N-terminal His-tags can be detrimental for proper heme incorporation in some G. sulfurreducens cytochromes, so tag position should be carefully considered .

How do the structural features of G. sulfurreducens cytochromes contribute to their electron transfer capabilities?

G. sulfurreducens cytochromes have specialized structural features that optimize electron transfer:

  • Branched heme arrangements: In proteins like OmcZ, this configuration creates highly surface-exposed hemes in every subunit, facilitating electron transfer. The surface exposed area of heme 6 in OmcZ is approximately 326 Ų, while the largely buried heme 5 has only about 12 Ų of exposed surface area .

  • Filament formation: Some cytochromes like OmcZ can form filamentous structures, increasing the electron transfer network .

  • Heme exposure patterns: Unlike the linear "molecular wire" arrangement in some bacterial electron transfer proteins, G. sulfurreducens cytochromes often have branched arrangements that introduce additional solvent-exposed hemes, similar to the MtrC portion of the MtrABC complex in other bacteria .

What are the current methods for characterizing protein-protein interactions in the electron transfer pathways of G. sulfurreducens?

Several complementary techniques are used to characterize protein-protein interactions in G. sulfurreducens:

  • Reconstitution studies: Isolated protein complexes can be reconstituted in proteoliposomes to study electron transfer across lipid bilayers, as demonstrated with the Pcc protein complexes .

  • DNA-protein binding assays: These assays identify direct binding between transcriptional regulators and promoter regions of genes encoding electron transfer proteins .

  • Small angle X-ray scattering (SAXS): This technique helps determine shape parameters for cytochromes and compare them with homologous proteins of known structure .

  • Heme-staining and western blotting: These methods quantify and identify specific c-type cytochromes in different cellular fractions or mutant strains .

How do transcriptional regulators control electron transfer processes in G. sulfurreducens?

Transcriptional regulators play a crucial role in controlling electron transfer processes:

  • GSU1771: This global regulator controls extracellular electron transfer and exopolysaccharide synthesis. Deletion of this regulator leads to increased expression of c-type cytochromes including OmcS and OmcZ, resulting in thicker and more electroactive biofilms .

  • GSU0514: This putative transcriptional regulator affects metabolic pathways. Mutations in this gene can significantly impact substrate utilization through regulation of metabolic enzymes like succinyl-CoA synthase .

These regulators function by binding to specific promoter regions, as demonstrated by DNA-protein binding assays showing direct binding of GSU1771 to the promoter regions of pgcA, pulF, relA, and gsu3356 .

What are the most effective approaches for studying electron transfer to different electron acceptors in G. sulfurreducens?

Research on G. sulfurreducens electron transfer employs several specialized techniques:

  • Catalytic cyclic voltammetry: This electrochemical technique can reveal shifts in driving force required for electron transfer out of the cell, as demonstrated in studies of the ΔcbcL strain .

  • Electrode-based growth systems: Growing G. sulfurreducens on poised electrodes allows researchers to precisely control the redox potential and measure electron transfer rates .

  • Reconstituted proteoliposome systems: Isolated protein complexes reconstituted in proteoliposomes can transfer electrons from reduced methyl viologen across lipid bilayers to Fe(III)-citrate and ferrihydrite, allowing assessment of electron transfer capabilities .

  • Comparative analysis of growth on different electron acceptors: Comparing growth on various electron acceptors (fumarate vs. Fe(III) oxide) can reveal the specificity of electron transfer pathways .

How can adaptive laboratory evolution be utilized to enhance functional properties of G. sulfurreducens?

Adaptive laboratory evolution has proven effective for enhancing substrate utilization in G. sulfurreducens:

  • Serial transfer protocol: Successive generations are grown with selection pressure (such as a specific electron donor or acceptor) to develop adapted strains. This approach was successfully used to adapt G. sulfurreducens to efficiently metabolize lactate, which wild-type strains couldn't utilize effectively .

  • Parallel evolution experiments: Running multiple parallel evolution experiments allows identification of convergent mutations, which are particularly informative. Five parallel cultures evolved to metabolize lactate all acquired mutations in the same gene (GSU0514) .

  • Genome resequencing: This identifies mutations that arise during adaptation. In the lactate utilization study, all five adaptively evolved strains had non-synonymous single-nucleotide polymorphisms in GSU0514 .

  • Mutation verification: Introducing identified mutations into wild-type strains confirms their functional significance. When the single-base-pair mutation from one evolved strain was introduced into the wild-type strain, it conferred rapid growth on lactate .

What bioinformatic approaches are most useful for analyzing G. sulfurreducens genome and protein data?

Several bioinformatic approaches have proven valuable for G. sulfurreducens research:

  • Comparative genomics: The pcc gene clusters found in G. sulfurreducens have been identified in all eight sequenced Geobacter species and 11 other bacterial genomes from six different phyla, demonstrating the evolutionary conservation of these important protein complexes .

  • Transcriptomic analysis: RNA-seq comparing wild-type and mutant strains helps identify differentially expressed genes. In the Δgsu1771 biofilm grown on glass, 467 differentially expressed genes were identified (167 upregulated and 300 downregulated) .

  • Promoter analysis: Identifying binding sequences for transcriptional regulators helps understand regulatory networks. DNA-binding assays demonstrated that GSU0514 bound to the promoter of the succinyl-CoA synthase operon, with the binding sequence not appearing elsewhere in the genome .

How should researchers interpret changes in cytochrome expression levels in different G. sulfurreducens strains or growth conditions?

Interpreting changes in cytochrome expression requires consideration of several factors:

  • Growth substrate effects: Different electron donors and acceptors can dramatically affect cytochrome expression patterns. For example, Δgsu1771 biofilms grown on conductive (graphite electrode) versus non-conductive (glass) surfaces show different gene expression patterns, with 119 versus 467 differentially expressed genes, respectively .

  • Regulatory cascade effects: Changes in one cytochrome may affect the expression of others through regulatory feedback. Deletion of GSU1771 leads to increased expression of multiple c-type cytochromes including OmcS and OmcZ .

  • Functional redundancy: G. sulfurreducens contains multiple electron transfer pathways. CbcL is essential for electron transfer to low-potential acceptors, while ImcH is required for electron transfer to higher-potential acceptors, demonstrating functional specialization .

  • Biofilm development stage: Cytochrome expression varies with biofilm development stage, with some cytochromes being more important for initial attachment and others for mature biofilm electron transfer .

What are the most promising areas for future research on G. sulfurreducens proteins?

Several promising research directions emerge from current findings:

  • Structure-function relationships in multiheme cytochromes: Further characterization of the unique structural features of G. sulfurreducens cytochromes, such as the branched heme arrangement in OmcZ, could lead to better understanding of their exceptional electron transfer capabilities .

  • Regulatory networks controlling electron transfer: Expanding our understanding of how transcriptional regulators like GSU1771 and GSU0514 control electron transfer processes could provide insights into how these pathways are coordinated and integrated .

  • Adaptive evolution for enhanced bioremediation: Building on successful adaptive evolution for lactate metabolism, exploring adaptation to other environmentally relevant substrates could enhance bioremediation applications .

  • Protein engineering of electron transfer components: Using recombinant protein expression systems to create modified versions of electron transfer proteins could lead to enhanced capabilities for biotechnological applications .

How might knowledge of G. sulfurreducens proteins contribute to biotechnological applications?

G. sulfurreducens protein research has several potential biotechnological applications:

  • Improved microbial fuel cells: Enhanced understanding of electron transfer mechanisms could lead to more efficient bioelectricity generation systems .

  • Biosensors: Engineered G. sulfurreducens strains or isolated proteins could serve as sensitive detectors for environmental contaminants.

  • Bioremediation optimization: Understanding how G. sulfurreducens adapts to different substrates could improve bioremediation strategies for metal-contaminated environments .

  • Protein-based electronic components: The unique electron transfer properties of G. sulfurreducens cytochromes might be harnessed for bioelectronic devices or biocompatible interfaces.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.