Recombinant Geobacter sulfurreducens Protoheme IX farnesyltransferase (ctaB)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Metabolic Role

ctaB is pivotal in cytochrome biogenesis:

  • Heme O Synthesis: Converts protoheme IX to heme O, a precursor for heme A in cytochrome c oxidases .

  • Electron Transport: Supports extracellular electron transfer (EET) pathways in G. sulfurreducens by ensuring cytochrome functionality .

  • Stress Response: Downregulated under oxidative stress, correlating with reduced cytochrome activity .

Key Research Findings:

  • Deletion of ctaB disrupts Fe(III) and Mn(IV) oxide reduction but not electrode respiration .

  • Purified ctaB binds Fe(III) oxides, accelerating Fe(III) reduction in cell suspensions .

3.1. Industrial and Environmental Applications

  • Bioelectrochemical Systems: Enhances current production in microbial fuel cells via cytochrome optimization .

  • Bioremediation: Facilitates metal oxide reduction for groundwater detoxification .

3.2. Molecular Studies

  • Protein Interaction Assays: Used in ELISA to study cytochrome assembly pathways .

  • Genetic Complementation: Restores Fe(III) reduction in ΔctaB mutants .

Table 2: Expression and Functional Data

ConditionctaB Expression Level (Fold Change)Functional Impact
Oxidative Stress↓ 0.044–0.051 Impaired cytochrome assembly
Fe(III) Citrate Reduction↔ No change Unaffected soluble Fe(III) respiration
Electrode Respiration↔ No change Maintained current density

Comparative Analysis with Homologs

ctaB shares functional parallels with heme synthases in other bacteria:

  • Bacillus subtilis: ctaB homologs show similar farnesyltransferase activity but differ in membrane localization .

  • Shewanella oneidensis: Heterologous ctaB expression yields processed 41 kDa forms, mimicking native Geobacter isoforms .

Challenges and Future Directions

  • Structural Resolution: Full 3D structure determination is needed to elucidate substrate-binding mechanisms .

  • Biotechnological Engineering: Optimizing ctaB expression could enhance EET efficiency in synthetic biology applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ctaB; GSU0223; Protoheme IX farnesyltransferase; Heme B farnesyltransferase; Heme O synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Target Names
ctaB
Target Protein Sequence
MTRQDLVLFRPRLALLNGIAAVAGHALVPDAAHATLWVALAGVAILAAGGSALNQVLERD LDRLMERTRQRPLPRGDLSPAMATALGCACIGTGLLVLAAGGPVPPLLGAVALAWYLAVY TPLKRRTSLALAIGAVSGALPPVIGWTLAGGAPGDYRIILLAGIFFLWQVPHFWLFQRRH ADDYRRAGIPLFTPGAGRLGPSFHVRLWLGALAASVLLLPAFGLMAPRMAPWIAAVPLLL LPVCRPRSEATLFSCLNAFPPLMALALLLR
Uniprot No.

Target Background

Function
This enzyme converts heme B (protoheme IX) to heme O by substituting the vinyl group at carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl side group.
Database Links

KEGG: gsu:GSU0223

STRING: 243231.GSU0223

Protein Families
UbiA prenyltransferase family, Protoheme IX farnesyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Protoheme IX farnesyltransferase and what is its specific function in Geobacter sulfurreducens?

Protoheme IX farnesyltransferase (encoded by the ctaB gene in G. sulfurreducens) converts heme B (protoheme IX) to heme O by substituting the vinyl group on carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl side group . This modification is critical for the respiratory chain in G. sulfurreducens, particularly for its unique electron transfer capabilities. The enzyme is located in the cell inner membrane as a multi-pass membrane protein . In G. sulfurreducens, this enzyme plays a crucial role in the cytochrome-rich respiratory system that allows the organism to transfer electrons to extracellular metals and electrodes .

What are the optimal conditions for expressing functional recombinant G. sulfurreducens Protoheme IX farnesyltransferase?

Expressing functional recombinant G. sulfurreducens ctaB requires careful consideration of several factors:

  • Expression system selection: While E. coli is commonly used as a host for heterologous protein expression, the membrane-bound nature of ctaB presents challenges. Based on methodology used for similar proteins, fusion tags like trigger factor (TF) can significantly improve protein solubility and folding .

  • Anaerobic considerations: Since G. sulfurreducens is an anaerobic organism, protein folding and activity may be sensitive to oxygen. A strategy that has proven effective for other G. sulfurreducens proteins is to:

    • Express the protein aerobically with protective fusion tags

    • Purify under denaturing conditions (using 8M urea)

    • Perform refolding under strict anaerobic conditions with appropriate cofactors

  • Metal supplementation: Including iron (FeCl₃) and sulfur (Na₂S) in reconstitution buffers is critical for proper formation of Fe-S clusters that may be required for ctaB function .

  • Storage conditions: Store purified protein at -20°C in 50% glycerol buffer to maintain stability. For extended storage, -80°C is recommended, with repeated freeze-thaw cycles avoided .

How can the activity of recombinant Protoheme IX farnesyltransferase be assayed?

Activity assay for recombinant ctaB can be performed using the following approaches:

Spectroscopic method:

  • Monitor the conversion of protoheme IX to heme O using UV-Vis spectroscopy, looking for characteristic shifts in absorption spectra

  • Assess the integrity of cofactors through spectroscopic analysis similar to methods used for cytochrome c peroxidases from G. sulfurreducens

HPLC-based method:

  • Extract hemes from reaction mixtures using acidified acetone

  • Separate and quantify protoheme IX and heme O using reverse-phase HPLC

  • Calculate enzyme activity based on the rate of heme O formation

Mass spectrometry validation:

  • Confirm the identity of reaction products using LC-MS/MS

  • Look for the specific mass shift corresponding to the addition of the farnesyl group

How does ctaB contribute to the electron transport chain in G. sulfurreducens?

G. sulfurreducens possesses a complex electron transport system with at least three distinct electron transfer pathways for respiration, adapting to different redox potentials of electron acceptors . The ctaB enzyme produces heme O, which is incorporated into terminal oxidases and other components of the respiratory chain. This integration is critical for:

  • Respiratory flexibility: Enabling G. sulfurreducens to utilize a wide range of electron acceptors including Fe(III), Mn(IV), and electrodes

  • Energy conservation: Contributing to the proton motive force generation during electron transport, especially important for a bacterium with high iron content (2 ± 0.2 μg/g dry weight) and significant lipid composition (32 ± 0.5% dry weight/dry weight)

  • Redox sensing: Potentially participating in regulatory mechanisms that allow G. sulfurreducens to detect and respond to changes in environmental redox conditions

Research suggests that cytochrome expression shifts in G. sulfurreducens depending on the redox potential of electron acceptors, with different pathways activated at different potential ranges . The heme O synthesized by ctaB likely plays a key role in these adaptive responses.

What genetic systems are most effective for manipulating ctaB in G. sulfurreducens?

Several genetic systems have been developed for G. sulfurreducens that can be applied to ctaB manipulation:

Scarless genome editing:
The SacB/sucrose counterselection strategy allows for precise, marker-free gene deletions and modifications in G. sulfurreducens . This approach:

  • Utilizes suicide vectors (like pK18mobsacB) containing homologous regions flanking the target gene

  • Selects for single crossover integration using kanamycin

  • Uses sucrose selection to obtain double crossover events

  • Results in scarless genome modifications

Stable inducible expression systems:
For controlled expression of ctaB variants, RK2-based plasmids have shown superior stability in G. sulfurreducens compared to pBBR1 plasmids, being maintained for over 15 generations without antibiotic selection . The vanillate-inducible system (pRK2-Geo2i) provides:

  • Controlled expression through VanR-dependent induction

  • Stable maintenance without constant antibiotic pressure

  • Tunable expression levels by varying vanillate concentration

Homologous recombination approach:
For targeted gene replacement, the approach used for gltA gene replacement can be adapted:

  • Create a linear DNA fragment with an antibiotic resistance gene flanked by ~0.7 kb DNA fragments homologous to regions upstream and downstream of ctaB

  • Introduce this construct via electroporation

  • Select transformants on appropriate antibiotics

  • Confirm recombination by PCR and sequencing

What methods can be used to optimize heterologous expression of ctaB for structural and functional studies?

For optimal heterologous expression of ctaB, researchers should consider:

Expression vector optimization:

  • Test multiple fusion partners including MBP, SUMO, or trigger factor to improve solubility

  • Incorporate a TEV protease cleavage site for tag removal

  • Utilize specialized vectors like pET23b (successfully used for G. sulfurreducens proteins)

Codon optimization:

  • Adjust codon usage to match the expression host

  • Remove rare codons that might impede translation

  • Consider the GC content of the optimized sequence

Induction conditions:

  • Test various induction temperatures (16°C, 25°C, 30°C)

  • Optimize inducer concentration and induction duration

  • Consider auto-induction media for gradual protein expression

Solubilization and purification strategies:
For membrane proteins like ctaB, specialized approaches are needed:

  • Screen detergents for optimal solubilization (DDM, LDAO, DMNG)

  • Consider lipid nanodiscs or amphipols for maintaining native-like environment

  • Implement multi-step purification including affinity, ion exchange, and size exclusion chromatography

How can advanced structural analysis techniques be applied to study G. sulfurreducens ctaB?

To elucidate the structure-function relationship of ctaB, researchers can employ:

Cryo-electron microscopy (Cryo-EM):

  • Purify protein to high homogeneity (>95%)

  • Prepare grids with optimal protein concentration

  • Collect high-resolution images and process using software like RELION or cryoSPARC

  • Generate 3D reconstructions to reveal membrane topology and substrate binding sites

X-ray crystallography:
Despite challenges with membrane proteins:

  • Screen hundreds of crystallization conditions using nanoliter-scale droplets

  • Optimize promising conditions by varying pH, precipitant concentration, and additives

  • Collect diffraction data at synchrotron radiation facilities

  • Solve the structure using molecular replacement or experimental phasing methods

Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Expose the protein to D₂O for various time intervals

  • Quench the exchange reaction and digest the protein

  • Analyze the deuterium incorporation by LC-MS

  • Map dynamics and solvent exposure to functional regions

What analytical techniques can detect potential interactions between ctaB and other proteins in the electron transport chain?

Understanding protein-protein interactions involving ctaB requires:

Co-immunoprecipitation (Co-IP):

  • Generate antibodies against ctaB or use epitope-tagged versions

  • Lyse G. sulfurreducens cells under mild conditions to preserve interactions

  • Immunoprecipitate ctaB and identify co-precipitating proteins using mass spectrometry

  • Validate interactions through reciprocal Co-IP experiments

Proximity-based labeling:

  • Generate fusion proteins of ctaB with BioID or APEX2

  • Express in G. sulfurreducens using the genetic systems described above

  • Activate the labeling enzyme to biotinylate proteins in proximity to ctaB

  • Purify biotinylated proteins and identify them by mass spectrometry

Crosslinking mass spectrometry:

  • Treat intact cells or membrane fractions with crosslinking reagents

  • Enrich for ctaB-containing complexes

  • Perform tryptic digestion and analyze by LC-MS/MS

  • Identify crosslinked peptides to map interaction interfaces

How does G. sulfurreducens ctaB compare to homologous enzymes in other bacteria?

Comparative analysis reveals important distinctions:

SpeciesGene NameProtein SizeCellular LocationKey Functional Differences
G. sulfurreducensctaB270 aa, 31 kDaInner membraneAdapted for metal-reducing respiratory chain
Pseudomonas aeruginosacyoE296 aa, 31.8 kDaInner membraneFunctions within aerobic respiratory chain
Escherichia colicyoE~300 aaInner membranePart of cytochrome bo complex, essential for heme O biosynthesis

In E. coli, the cyoE gene product (homologous to ctaB) is encoded by the cyoABCDE operon and functions as a protoheme IX farnesyltransferase essential for heme O biosynthesis . When cyoE is deleted or mutated, the cytochrome bo complex becomes non-functional, with spectroscopic analysis showing substitution of protoheme IX for heme O at the high-spin heme binding site .

The G. sulfurreducens ctaB likely evolved specialized features to function within its unique electron transport system adapted for metal reduction in anaerobic environments .

What insights can be gained from studying ctaB across different Geobacter species?

Cross-species analysis within Geobacter provides valuable insights:

  • Evolutionary adaptation: Comparing ctaB sequence conservation across Geobacter species reveals how this enzyme has adapted to different ecological niches and electron acceptors

  • Functional diversification: G. metallireducens, a close relative of G. sulfurreducens, shows different metal content and reduction capabilities . Comparative analysis of ctaB between these species could reveal how heme modification contributes to these differences

  • Regulatory differences: Different Geobacter species employ varying strategies for electron transport. For example, G. sulfurreducens utilizes conductive pili and specific cytochromes for metal reduction . Studying how ctaB is regulated across species can illuminate how heme O biosynthesis is integrated into these different strategies

Researchers should consider:

  • Performing phylogenetic analysis of ctaB across Geobacter species

  • Conducting complementation studies to test functional conservation

  • Investigating expression patterns of ctaB homologs under different growth conditions

What bioinformatic tools can be used to predict ctaB function and regulatory elements?

Several computational approaches are valuable for ctaB analysis:

Protein structure prediction:

  • AlphaFold2 or RoseTTAFold for generating accurate structural models

  • SWISS-MODEL for homology modeling based on known structures

  • TMHMM or TOPCONS for predicting transmembrane topology

  • ConSurf for mapping evolutionary conservation onto structural models

Regulatory element analysis:

  • MEME Suite for motif discovery in promoter regions

  • RegPrecise for comparative genomics of regulatory elements

  • Virtual Footprint for prediction of transcription factor binding sites

  • ARNold for detection of intrinsic terminators and attenuators

Functional prediction:

  • InterProScan for domain and motif identification

  • KEGG and BioCyc for metabolic pathway mapping

  • STRING for protein-protein interaction network analysis

  • TIGRFAMs and Pfam for family assignment

How can transcriptomic data be leveraged to understand ctaB regulation in the context of electron transport?

Transcriptomic analysis provides critical insights into ctaB regulation:

  • Differential expression analysis:

    • Compare ctaB expression across different electron acceptor conditions (Fe(III), electrodes at different potentials, etc.)

    • Identify co-expressed genes, potentially revealing functional associations

    • Use tools like DESeq2 or edgeR for statistical analysis of count data

  • Regulatory network reconstruction:

    • Apply algorithms like WGCNA (Weighted Gene Co-expression Network Analysis) to identify gene modules

    • Use inference algorithms (GENIE3, ARACNE) to predict regulatory relationships

    • Validate key predictions using techniques like ChIP-seq or EMSA

  • Integration with other omics data:

    • Combine transcriptomics with proteomics for more comprehensive understanding

    • Compare transcriptomic responses with metabolomic changes

    • Look for post-transcriptional regulation by comparing mRNA and protein levels

Previous studies with G. sulfurreducens have successfully used transcriptomics to understand gene regulation during Pd(II) reduction , with RT-qPCR confirming upregulation or downregulation of specific cytochromes. Similar approaches can be applied to study ctaB regulation.

What are the common challenges in working with G. sulfurreducens ctaB and how can they be addressed?

Researchers may encounter several challenges:

Anaerobic cultivation requirements:

  • Challenge: G. sulfurreducens is an anaerobe, making routine culture maintenance difficult

  • Solution: Use anaerobic chambers or specialized techniques like the Hungate method; consider fumarate as an electron acceptor for easier cultivation

Protein solubility issues:

  • Challenge: Membrane proteins like ctaB are often difficult to solubilize and purify

  • Solution: Screen multiple detergents; consider fusion tags that enhance solubility; use specialized purification methods for membrane proteins

Functional reconstitution:

  • Challenge: Maintaining activity during purification and reconstitution

  • Solution: Perform reconstitution under strict anaerobic conditions with appropriate cofactors; consider reconstitution into liposomes or nanodiscs to provide a lipid environment

Expression toxicity:

  • Challenge: Overexpression of membrane proteins can be toxic to host cells

  • Solution: Use tightly controlled inducible promoters; lower induction temperature; consider specialized expression strains designed for toxic proteins

How can researchers troubleshoot issues with recombinant ctaB activity?

When recombinant ctaB shows poor activity, consider:

Cofactor incorporation:

  • Ensure proper incorporation of heme and potential Fe-S clusters

  • Supplement expression media with iron and/or δ-aminolevulinic acid (ALA)

  • Perform reconstitution with purified heme B as substrate

Buffer optimization:

  • Test various buffer compositions (pH, salt concentration)

  • Include glycerol or other stabilizing agents

  • Remove potential inhibitors (e.g., certain detergents may inhibit activity)

Enzyme kinetics analysis:

  • Perform detailed kinetic analysis to identify potential bottlenecks

  • Test for product inhibition

  • Optimize substrate concentrations

Protein quality assessment:

  • Check for proper folding using circular dichroism (CD) spectroscopy

  • Assess oligomerization state using size exclusion chromatography

  • Verify integrity of key domains using limited proteolysis followed by mass spectrometry

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.