Recombinant Geobacter uraniireducens ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Geobacter uraniireducens ATP synthase subunit a (atpB) is a bacterially expressed protein critical for the function of ATP synthase, an enzyme responsible for ATP production via oxidative phosphorylation. This subunit forms part of the FO region of the ATP synthase complex, facilitating proton translocation across membranes to drive ATP synthesis . Derived from Geobacter uraniireducens—a dissimilatory metal-reducing bacterium prevalent in subsurface environments—this recombinant protein is utilized in structural, biochemical, and metabolic studies .

Production and Purification

Expression Systems

  • Host: Escherichia coli is the primary expression host due to high yield and compatibility with His-tag purification .

  • Purification: Affinity chromatography using nickel-nitrilotriacetic acid (Ni-NTA) matrices, followed by buffer exchange into Tris-based storage solutions .

Mechanistic Role in ATP Synthesis

  • Subunit a facilitates proton translocation via two offset half-channels, enabling a rotary mechanism that couples proton flow to ATP synthesis .

  • In G. uraniireducens, the F-type ATP synthase (including subunit a) coexists with a V-type ATPase, suggesting metabolic versatility in energy conservation under varying environmental conditions .

Comparative Analysis Across Geobacter Species

SpeciesATP Synthase TypeSubunit a HomologyKey Functional Difference
G. uraniireducensF-type100%Dual ATPase system
G. sulfurreducensF-type89%Single ATPase complex
G. anodireducensF- and V-type92%Hybrid ATPase capacity

Homology data based on IMG/MER functional category comparisons .

Research Applications

  • Enzyme Kinetics: Used to study proton coupling efficiency and rotational dynamics in ATP synthases .

  • Antibody Development: Serves as an antigen for generating species-specific antibodies in metabolic studies .

  • Bioremediation Studies: Insights into Geobacter energy metabolism inform strategies for uranium-contaminated groundwater remediation .

Challenges and Future Directions

  • Structural Resolution: Full atomic-level details of subunit a’s transmembrane helices remain unresolved, necessitating cryo-EM studies .

  • Biotechnological Engineering: Optimizing expression systems to improve yield for industrial-scale applications .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is preferred, please contact us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Gura_4248; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Geobacter uraniireducens (strain Rf4) (Geobacter uraniumreducens)
Target Names
atpB
Target Protein Sequence
MVHPYLFLQFFRKLLEPLHISEAGADAIAYTWLIIALLLILSMLATKGLKTVPGGLQNFM EVIIGGVENMVVETMGHHGKPFFPLIATLAIFILVSNLIGLVPGFFPPTANINTTAACAV IVFVTTHVVGIKEHGFKYIKHFLGPILWLAPMMFFIEVIGHFSRVISLTLRLFGNMNGHE LVLMIFFGLAPFLVPLPMMLMGVLVSFIQAFVFMLLAMIYIQGSLEEGH
Uniprot No.

Target Background

Function
As a key component of the proton channel, this protein plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ATP synthase subunit a (atpB) in Geobacter uraniireducens?

ATP synthase subunit a is an integral membrane protein component of the F₀ sector of the F₁F₀ ATP synthase complex. It forms part of the proton channel and plays a critical role in the proton-motive force-driven synthesis of ATP. Based on homology with G. sulfurreducens, the atpB subunit likely contains approximately 229 amino acids and forms a hydrophobic structure with multiple transmembrane segments that participate in proton translocation across the membrane . This subunit works in concert with other components of the ATP synthase complex to couple proton movement to the rotary catalysis mechanism that drives ATP synthesis, a crucial process for energy conservation in Geobacter species during their respiratory processes .

How does G. uraniireducens atpB relate to extracellular electron transfer capabilities?

G. uraniireducens, like other Geobacter species, performs extracellular electron transfer (EET) to respire using external electron acceptors. While ATP synthase doesn't directly participate in the electron transport chain, it plays a fundamental role in energy conservation resulting from the electrochemical gradient generated during respiration. G. uraniireducens can secrete significant amounts of riboflavin (up to 270 nM) to facilitate EET . Changes in ATP demand have been shown to significantly impact respiration rates in Geobacter species, with engineering of the ATP synthase complex resulting in modified cellular energetics and respiratory capabilities . The interplay between ATP synthesis, bioenergetics, and electron transfer makes the study of recombinant atpB potentially valuable for understanding energy conservation mechanisms in this unique bacterium.

What expression systems are most effective for producing recombinant G. uraniireducens ATP synthase subunit a?

Recombinant expression of membrane proteins like atpB presents several challenges due to their hydrophobic nature. Based on successful approaches with related proteins:

Table 1: Recommended Expression Systems for G. uraniireducens atpB

Expression SystemAdvantagesConsiderationsTag Recommendations
E. coli BL21(DE3)Well-established, high yield potentialMay require codon optimizationN-terminal His6 tag with TEV cleavage site
Cell-free systemsAvoids toxicity issues, rapidHigher cost, lower yieldC-terminal Strep-tag II
Geobacter native expressionProper folding, post-translational modificationsTechnically challengingIPTG-inducible promoter system

For optimal expression, use Tris-based buffer systems with 50% glycerol for stabilization, as recommended for similar Geobacter proteins . The expression construct design should account for the transmembrane topology of atpB to minimize misfolding. An IPTG-inducible system has proven effective for expressing F₁ portion of ATP synthase in G. sulfurreducens , suggesting a similar approach may work for atpB expression.

How can researchers validate the proper folding and function of recombinant G. uraniireducens atpB?

Functional validation of recombinant atpB requires multiple complementary approaches:

  • Structural integrity assessment: Circular dichroism spectroscopy to confirm secondary structure composition, particularly the alpha-helical content characteristic of membrane proteins.

  • Reconstitution assays: Incorporate purified atpB into liposomes with other ATP synthase components to measure proton translocation using pH-sensitive fluorescent dyes.

  • ATP synthesis/hydrolysis assays: Following the methodology described for G. sulfurreducens, measure ATP synthesis rates in reconstituted proteoliposomes under a proton gradient .

  • Binding studies: Assess interaction with other F₀ subunits, particularly the c-ring, using crosslinking or co-immunoprecipitation techniques.

  • Complementation studies: Express recombinant atpB in atpB-knockout strains to assess functional rescue of ATP synthesis capability.

The quality of recombinant protein should be verified by SDS-PAGE and Western blotting before functional assays. Proper storage at -20°C or -80°C with 50% glycerol is essential for maintaining protein integrity, with avoidance of repeated freeze-thaw cycles .

How do G. uraniireducens and G. sulfurreducens atpB compare in structure and function?

While specific structural data for G. uraniireducens atpB is limited, comparative analysis with the well-characterized G. sulfurreducens homolog provides valuable insights:

Table 2: Comparative Analysis of atpB in Geobacter Species

FeatureG. sulfurreducens atpBG. uraniireducens atpB (predicted)Functional Implications
Amino acid length229 residues Likely similar lengthConserved core structure
Transmembrane helicesMultiple membrane-spanning domainsLikely similar topologyConserved proton channel function
Sequence homologyReference sequenceExpected high homology (>70%)Similar core function with potential species-specific adaptations
Role in metabolismCritical for ATP synthesis during respirationSimilar essential roleBoth species depend on ATP synthase for energy conservation
Associated phenotypesModulation affects respiration rates Expected similar relationshipPotential target for metabolic engineering

G. uraniireducens exhibits unique extracellular electron transfer capabilities, particularly its abundant riboflavin secretion , which may correspond to adaptations in its bioenergetic machinery, potentially including subtle modifications to ATP synthase components like atpB.

Can G. uraniireducens atpB be targeted to enhance extracellular electron transfer capabilities?

Based on successful approaches with G. sulfurreducens, engineering G. uraniireducens ATP synthase could potentially enhance electron transfer rates:

  • ATP drain approach: Similar to the strategy employed in G. sulfurreducens , overexpressing the F₁ portion of ATP synthase creates an ATP drain that increases respiration rates. This approach decreased cellular ATP content by more than half and resulted in higher respiration rates in G. sulfurreducens.

  • Riboflavin coupling: G. uraniireducens naturally secretes riboflavin that acts in two modes - as bound redox cofactors for cytochromes and as electron shuttles for Fe(III) oxide reduction . Engineering atpB to influence the proton motive force could potentially affect riboflavin secretion pathways.

  • C-terminal modifications: Drawing from research on mycobacterial ATP synthase, where the C-terminus of the α-subunit regulates ATPase activity , strategic modifications to G. uraniireducens atpB might modulate ATP synthesis/hydrolysis balance.

Experimental validation would require measuring changes in:

  • ATP synthesis rates

  • Respiratory flux measurements

  • Riboflavin secretion quantification

  • Extracellular electron transfer rates to various acceptors

What are optimal conditions for storage and handling of recombinant G. uraniireducens atpB?

Proper handling of recombinant atpB is critical for maintaining functional integrity:

  • Storage buffer composition: Use Tris-based buffer with 50% glycerol, optimized for protein stability.

  • Temperature considerations: Store at -20°C for routine use, or -80°C for extended storage periods.

  • Working practices:

    • Avoid repeated freeze-thaw cycles

    • Prepare working aliquots and store at 4°C for up to one week

    • Include appropriate protease inhibitors when handling

  • Detergent selection: For membrane protein purification and reconstitution, mild detergents like DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) help maintain native conformation.

  • Oxidation prevention: Include reducing agents (e.g., DTT or β-mercaptoethanol) at appropriate concentrations to prevent disulfide bond formation and oxidative damage.

How can expression levels of native atpB be monitored in Geobacter cultures?

Monitoring expression of ATP synthase components in Geobacter species requires sensitive analytical approaches:

  • Transcript quantification: RT-qPCR can be used to measure atpB transcript abundance, similar to the approach used for monitoring metabolic status in Geobacter species through citrate synthase expression .

  • Protein quantification: Western blotting with antibodies against recombinant atpB can quantify protein levels. Based on approaches used for citrate synthase, protein abundance can correlate with metabolic rates - citrate synthase protein at higher growth rates (105.7 ± 7.31 ng/μg total protein) was approximately twice that at lower growth rates (48.1 ± 3.77 ng/μg total protein) .

  • Activity-based monitoring: Measuring ATP synthesis rates in membrane vesicles can provide functional assessment of ATP synthase complex activity.

  • Environmental response: Expression levels can be correlated with electron acceptor availability and growth conditions, as demonstrated with citrate synthase tracking in response to acetate amendments .

What are common pitfalls in expressing and purifying recombinant G. uraniireducens atpB?

Membrane protein expression and purification present several challenges:

Table 3: Common Challenges and Solutions for Recombinant atpB Work

ChallengePotential CausesSolutions
Low expression yieldToxicity to host, protein instabilityUse C41/C43 E. coli strains specialized for membrane proteins; lower induction temperature (16-20°C); optimize codon usage
Inclusion body formationImproper folding, overexpressionReduce expression rate; co-express chaperones; use fusion tags that enhance solubility
Loss of activity during purificationDetergent-induced conformational changesScreen multiple detergents; use lipid nanodiscs or amphipols for stabilization
Aggregation during storageProtein instabilityInclude glycerol (50%); store in smaller aliquots; avoid repeated freeze-thaw cycles
Poor reconstitution efficiencyImproper lipid compositionTest various lipid compositions that mimic Geobacter membrane environment

When functional assays show low activity, consider:

  • Verifying redox state of critical residues

  • Examining proton permeability of reconstituted systems

  • Assessing association with other ATP synthase components

How can researchers accurately measure the activity of recombinant G. uraniireducens atpB in experimental systems?

Direct measurement of isolated atpB activity is challenging as it functions as part of the ATP synthase complex. Several approaches can provide meaningful data:

  • Reconstituted proteoliposome assays: Incorporate purified atpB with other ATP synthase components into liposomes and measure:

    • ATP synthesis rates under artificial proton gradients

    • Proton translocation using pH-sensitive fluorescent probes

    • Rotation of the c-ring using single-molecule techniques

  • Complementation assays: Express recombinant atpB in strains with atpB mutations or deletions to assess functional rescue, measuring:

    • Growth rates on respiratory substrates

    • ATP synthesis capacity in membrane vesicles

    • Electron transfer rates to external acceptors

  • Binding assays with other subunits: Using techniques like:

    • Surface plasmon resonance (SPR)

    • Isothermal titration calorimetry (ITC)

    • FRET-based interaction studies

  • In vivo activity correlation: Similar to approaches that monitored citrate synthase as a metabolic indicator , correlate atpB expression/activity with:

    • Respiratory rates

    • ATP content

    • Extracellular electron transfer efficiency to electrodes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.