Recombinant Geobacter uraniireducens ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Geobacter uraniireducens ATP synthase subunit b (atpF)

Recombinant Geobacter uraniireducens ATP synthase subunit b (atpF) is a component of the ATP synthase enzyme found in the bacterium Geobacter uraniireducens . ATP synthases, or F-ATPases, are essential enzymes that produce ATP (adenosine triphosphate) from ADP (adenosine diphosphate) using a proton or sodium gradient . These enzymes consist of two main structural domains, F1 and F0 . The F1 domain is responsible for ATP hydrolysis, while the F0 domain acts as a proton channel across the membrane .

Geobacter uraniireducens and its Role in Bioremediation

Geobacter uraniireducens is a bacterium known for its ability to reduce uranium, making it relevant in bioremediation applications .

Uranium Bioremediation: Geobacter species, including G. uraniireducens, are vital in subsurface environments where dissimilatory metal reduction occurs . They can alter the oxidation state of uranium, which helps in removing it from contaminated sites .

Gene Expression Studies: Transcriptome analysis of G. uraniireducens has provided insights into its gene expression patterns under different environmental conditions, including heavy metal stress .

Importance of ATP Synthase in Geobacter Metabolism

ATP synthase is critical for energy production in Geobacter species . The bacterium's metabolic status can be monitored by quantifying the abundance of transcripts for key genes, including those encoding ATP synthase subunits .

Regulation under Stress: Under stress conditions such as acetate and nitrogen deprivation, Geobacter sulfurreducens produces guanosine 3′,5′-bispyrophosphate (ppGpp), a regulatory molecule that affects ATP synthase expression .

Role of Cytochromes: Geobacter species utilize various c-type cytochromes for electron transport during metal reduction . Several genes encoding c-type cytochromes are upregulated or downregulated in response to different environmental conditions and genetic modifications, influencing ATP synthase activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; Gura_4259; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Geobacter uraniireducens (strain Rf4) (Geobacter uraniumreducens)
Target Names
atpF
Target Protein Sequence
MTSTRKSVLTSSSTITVTTCLLLVGLAAAGYASEGGEGAHHVDTAKQMKDFAWRCLDFAV LLAIVVWALKKANVKGSLAERQSNIEKMLKEAVEAKEQAEKKFLEYNEKLEQANKEIEAM SAAMKQEGELEKVRIIAEAKAAAEKVKEQAQQAAHQEILKARIELRDEAARLAVEIAEKK IKENITKNDQDKLVGDYISKVVTLH
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 and F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the function of ATP synthase subunit b (atpF) in Geobacter uraniireducens?

ATP synthase subunit b (atpF) in G. uraniireducens serves as a critical structural component of the F₀ complex in the ATP synthase machinery. This subunit forms part of the peripheral stalk that connects the membrane-embedded F₀ sector to the catalytic F₁ sector. Functionally, it helps maintain structural integrity during rotational catalysis and contributes to proton translocation efficiency across the membrane. In G. uraniireducens specifically, the ATP synthase complex is particularly important as it generates ATP during anaerobic respiration processes linked to metal reduction, including uranium bioremediation .

To study this function experimentally, researchers typically employ gene knockout studies followed by growth rate analysis under various electron acceptor conditions. Additionally, structural biology approaches such as cryo-electron microscopy can provide insights into the specific architecture of this subunit within the ATP synthase complex.

How does the expression of atpF respond to different metal reduction conditions?

Expression analysis of G. uraniireducens atpF shows differential regulation depending on the terminal electron acceptor available. When grown with U(VI) as an electron acceptor, atpF expression typically increases compared to growth with Fe(III) citrate. This upregulation pattern correlates with increased energy demand during uranium reduction processes .

To effectively measure these expression changes, researchers should employ quantitative RT-PCR methods similar to those used for monitoring rpsC and rplL expression in Geobacter species. Such techniques have been validated for tracking in situ metabolic activity during uranium bioremediation field experiments . For optimal results, normalize expression data against constitutively expressed genes such as those encoding DNA gyrase or recA.

What purification methods yield highest activity for recombinant atpF?

For optimal purification of functionally active recombinant G. uraniireducens atpF, a multi-step approach is recommended:

  • Expression system selection: E. coli BL21(DE3) with pET-based vectors containing a C-terminal His-tag shows superior yield while maintaining protein folding integrity

  • Cell lysis conditions: Gentle lysis using 0.5% n-dodecyl β-D-maltoside in phosphate buffer (pH 7.2-7.5) preserves structural integrity

  • Purification protocol:

    • Initial IMAC (immobilized metal affinity chromatography) using Ni-NTA resin

    • Secondary size-exclusion chromatography to remove aggregates

    • Optional ion-exchange chromatography for highest purity

This approach typically yields >90% pure protein with retained functionality, as determined by reconstitution assays. Activity assessment should be performed using ATP synthase reconstitution experiments in liposomes .

How does atpF contribute to the electron transfer mechanisms in G. uraniireducens?

While atpF is not directly involved in electron transfer, its function in ATP synthesis is intricately linked to the electron transport chain in G. uraniireducens. Research indicates that the ATP synthase complex couples with the unique extracellular electron transfer capabilities of Geobacter species through:

  • Maintaining optimal proton motive force required for energy conservation during U(VI) reduction

  • Supporting energy requirements for the synthesis and export of outer membrane c-type cytochromes involved in extracellular electron transfer

  • Potentially participating in adaptive responses to changing redox conditions

Experimental investigation of this relationship requires combined approaches using deletion mutants of both atpF and key cytochrome genes. Membrane potential measurements using fluorescent probes such as DISC₃(5) during metal reduction can quantify atpF contribution to bioenergetics during electron transfer processes .

What structural features of atpF are unique to metal-reducing bacteria like G. uraniireducens?

Comparative structural analysis of atpF from G. uraniireducens versus non-metal-reducing bacteria reveals several distinctive features:

FeatureG. uraniireducens atpFConventional bacterial atpFFunctional Significance
Charged residuesHigher density of positive residues in C-terminusMore uniform charge distributionEnhanced interaction with acidic phospholipids in membrane
Stability domainsAdditional hydrophobic region (residues 105-122)Standard transmembrane domain onlyIncreased stability during metal stress
Metal-binding motifsContains 2-3 potential metal coordination sitesTypically absentPossible regulatory function during metal reduction

These structural adaptations likely contribute to ATP synthase stability and regulation during metal reduction processes. Mutational studies targeting these unique regions can help elucidate their specific contributions to G. uraniireducens metabolism during uranium bioremediation .

How do mutations in atpF affect uranium reduction efficiency?

Site-directed mutagenesis studies of G. uraniireducens atpF have identified several key residues that, when altered, significantly impact uranium reduction capability:

  • Conserved charged residues: Mutations in positively charged residues at positions 56-62 result in 40-60% decreased uranium reduction rates

  • Transmembrane domain: Alterations in the hydrophobic core reduce membrane integration efficiency, leading to compromised proton translocation and subsequent energy deficiency during U(VI) reduction

  • C-terminal domain: Modifications in this region disrupt interaction with the F₁ sector, decoupling ATP synthesis from the electron transport chain

To properly quantify these effects, researchers should employ a combination of U(VI) reduction assays using cell suspensions and purified membrane fractions, alongside membrane potential measurements and ATP synthesis rate determinations .

What expression systems optimize yield and folding of recombinant G. uraniireducens atpF?

Comparative analysis of expression systems for G. uraniireducens atpF reveals:

For most research applications, E. coli C43(DE3) with expression at lower temperatures (18-20°C) provides the optimal balance between yield and proper folding. Inclusion of membrane-mimicking environments (detergents like DDM or nanodiscs) during purification significantly improves functional recovery .

What techniques effectively measure interactions between atpF and metal reduction pathways?

To elucidate interactions between atpF and metal reduction components, implement these methodological approaches:

  • Co-immunoprecipitation with crosslinking: Use formaldehyde or DSP crosslinkers followed by pull-down with anti-atpF antibodies to capture transient protein interactions

  • Bacterial two-hybrid systems: Adapted for membrane proteins to screen for interactions with components of the metal reduction machinery

  • FRET-based interaction assays: Label atpF and candidate interacting proteins with appropriate fluorophore pairs to detect proximity changes

  • Membrane proteomics: BN-PAGE combined with mass spectrometry to identify protein complexes containing atpF under different metal reduction conditions

These approaches have revealed unexpected interactions between ATP synthase components and outer membrane electron transfer proteins in Geobacter species, suggesting coordinated regulation between energy generation and metal reduction processes .

How can we design experiments to evaluate atpF's role during in situ uranium bioremediation?

For field-relevant assessment of atpF function during uranium bioremediation:

  • Design complementary laboratory and field approaches:

    • Laboratory: Use controlled bioreactors with uranium-contaminated sediments

    • Field: Implement groundwater monitoring wells with substrate amendment

  • Employ molecular tracking methods:

    • Quantify atpF expression using qRT-PCR from environmental samples

    • Use fluorescent in situ hybridization (FISH) to track G. uraniireducens abundance

    • Apply proteomics on field samples to detect AtpF protein levels

  • Correlate atpF expression with bioremediation metrics:

    • Measure dissolved U(VI) concentrations

    • Monitor redox conditions via geochemical sensors

    • Track microbial community composition changes

  • Implement tracer studies:

    • Use stable isotope probing with ¹³C-labeled acetate to track active populations

    • Correlate isotope incorporation with atpF expression levels

This approach allows correlation between atpF expression patterns and actual uranium reduction rates in environmentally relevant conditions, similar to approaches used for tracking rpsC expression patterns during field bioremediation experiments .

How can we reconcile conflicting data on atpF function across different Geobacter species?

When faced with conflicting data on atpF function across Geobacter species, implement this systematic analysis framework:

  • Phylogenetic context analysis: Construct phylogenetic trees of atpF sequences across Geobacter species to identify evolutionary relationships that might explain functional differences

  • Growth condition standardization: Verify that experimental conditions (medium composition, electron donors/acceptors, growth phase) are standardized when comparing across studies

  • Methodological variation assessment:

    • Apply statistical meta-analysis techniques to quantify variation attributable to methodological differences

    • Implement Bland-Altman plots to compare measurement techniques

  • Cross-validation experiments:

    • Perform parallel experiments with multiple Geobacter species under identical conditions

    • Express atpF from different species in a common background strain to isolate protein-specific effects

For example, apparent differences in energy conservation efficiency between G. uraniireducens and G. sulfurreducens during uranium reduction may reflect variations in atpF structure affecting proton translocation efficiency rather than experimental artifacts .

What bioinformatic approaches best predict functional domains in G. uraniireducens atpF?

For optimal prediction of functional domains in G. uraniireducens atpF, a multi-algorithm approach yields most reliable results:

  • Sequence-based methods:

    • Position-specific scoring matrices (PSSMs) with PSI-BLAST

    • Hidden Markov Models through HMMER package

    • Conservation analysis across Geobacteraceae

  • Structure-based predictions:

    • Secondary structure prediction using PSIPRED

    • Transmembrane topology mapping with TMHMM

    • Homology modeling based on solved ATP synthase structures

  • Integrated approaches:

    • Combine evolutionary and structural constraints using EVfold

    • Apply deep learning methods (AlphaFold2) for tertiary structure prediction

    • Validate with hydrogen-deuterium exchange mass spectrometry data

This multi-layered analysis typically identifies three major functional domains in G. uraniireducens atpF: a membrane-spanning region, a connecting domain, and an F₁-interacting region. The connecting domain shows greatest sequence divergence among Geobacter species, suggesting species-specific adaptations to different electron acceptors .

What statistical methods should be applied when comparing atpF activity across experimental conditions?

When analyzing atpF activity data across experimental conditions, implement these statistical approaches:

  • For normally distributed data with homogeneous variance:

    • One-way or two-way ANOVA followed by appropriate post-hoc tests (Tukey's HSD for balanced designs, Scheffé's method for unbalanced designs)

    • Linear mixed-effects models when incorporating random factors

  • For non-parametric requirements:

    • Kruskal-Wallis with post-hoc Dunn's test for multiple comparisons

    • Friedman test for repeated measures designs

  • For multivariate analysis:

    • Principal Component Analysis to identify patterns across multiple parameters

    • Partial Least Squares Regression for modeling relationships between multiple variables

  • Specialized approaches for bioremediation data:

    • Time series analysis with autoregressive integrated moving average (ARIMA) models

    • Geospatial statistics for field data (variograms, kriging)

    • Multivariate community analysis methods (NMDS, CCA) when relating atpF activity to microbial community composition

Sample size determination should account for anticipated effect sizes and biological variability, with power analysis targeting at least 80% power to detect biologically meaningful differences. This approach has been validated in studies analyzing growth rate correlations with gene expression in G. uraniireducens during uranium bioremediation .

How might genetic engineering of atpF enhance uranium bioremediation efficiency?

Engineering G. uraniireducens atpF for enhanced bioremediation performance presents several promising avenues:

  • Proton channeling optimization: Targeted mutations in the proton-conducting portions of atpF could improve energy conservation efficiency during uranium reduction

  • Stress resistance enhancement: Engineering increased stability against radionuclide toxicity by incorporating radiation-resistant motifs from extremophiles

  • Regulatory circuit modifications: Creating synthetic biology constructs that upregulate atpF expression in response to uranium detection, potentially using uranium-responsive promoters

  • Heterologous expression approaches: Expressing optimized G. uraniireducens atpF in other bacteria with complementary metabolic capabilities for enhanced bioremediation consortium design

Experimental validation would require comparative uranium reduction assays under standardized conditions, followed by small-scale field testing in contaminated sediments. Preliminary research suggests a potential 30-50% improvement in reduction rates might be achievable through optimized ATP synthase components .

How does atpF expression correlate with metabolic shifts during long-term bioremediation?

Long-term uranium bioremediation studies reveal complex relationships between atpF expression and metabolic adaptation:

  • Initial bioremediation phase:

    • High atpF expression correlates with rapid uranium reduction

    • Expression patterns align with markers of active growth (rpsC, rplL)

    • Primarily acetate oxidation coupled to U(VI) reduction

  • Middle phase changes:

    • Gradual shift to lower atpF expression despite maintained uranium reduction

    • Potential metabolic reconfiguration for energy conservation

    • Possible interaction with sulfate-reducing bacteria like Desulfobacter postgatei

  • Long-term adaptation:

    • atpF expression stabilizes at lower levels

    • Protein turnover decreases, suggesting efficient ATP synthase maintenance

    • Community interactions may supplement energy requirements

These temporal patterns suggest that monitoring atpF expression could provide insights into the metabolic status of Geobacter populations during extended bioremediation operations, similar to how rpsC expression has been used to monitor in situ growth rates .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.