Recombinant Geobacter uraniireducens NADH-quinone oxidoreductase subunit A 1 (nuoA1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Geobacter uraniireducens NADH-quinone oxidoreductase subunit A 1 (nuoA1)

Recombinant Geobacter uraniireducens NADH-quinone oxidoreductase subunit A 1 (nuoA1) is a component of the proton-translocating NADH:quinone oxidoreductase complex, also known as complex I. This enzyme plays a crucial role in the respiratory chain of bacteria, facilitating the transfer of electrons from NADH to quinones, which is essential for generating a proton motive force (PMF) used in ATP synthesis .

Function and Structure

Complex I, including the nuoA1 subunit, is a multisubunit enzyme composed of 14 different subunits (nuoA to nuoN) in bacteria. The nuoA subunit is part of the membrane sector of the complex, which is integral to the bacterial inner membrane . The enzyme catalyzes the reaction NADH + quinone → NAD+ + quinol, coupling this redox reaction to proton translocation across the membrane .

Role in Bacterial Physiology

In bacteria, complex I is involved in various metabolic processes, including aerobic respiration and anaerobic respiration. It helps maintain the cellular redox balance by reoxidizing NADH produced during catabolic reactions like the tricarboxylic acid (TCA) cycle and fatty acid beta-oxidation . The presence of complex I is associated with specific lifestyles, such as aerobic respiration and phototrophy .

Research Findings and Phylogenomics

Phylogenomic analyses have revealed that complex I is widespread across bacteria, with about 50% of analyzed genomes containing the enzyme . Different classes of bacterial complex I participate in aerobic and anaerobic respiratory chains, indicating diverse roles in bacterial physiology . The evolution of complex I is largely congruent with the evolution of bacterial groups, suggesting significant horizontal gene transfer and gene loss events .

Data Table: Characteristics of NADH-quinone Oxidoreductase Complex I

CharacteristicsDescription
Subunit Composition14 subunits (nuoA to nuoN)
FunctionTransfers electrons from NADH to quinones, generating a PMF
LocationInner bacterial membrane
Reaction CatalyzedNADH + quinone → NAD+ + quinol
Physiological RoleMaintains redox balance, supports aerobic and anaerobic respiration
DistributionFound in approximately 50% of bacterial genomes

Challenges and Future Directions

While recombinant Geobacter uraniireducens NADH-quinone oxidoreductase subunit A 1 (nuoA1) is a valuable tool for studying complex I, there are limitations in its availability due to patent restrictions . Future research should focus on understanding the diverse roles of complex I in different bacterial lifestyles and exploring its potential applications in biotechnology and bioenergy fields.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA1; Gura_0334; NADH-quinone oxidoreductase subunit A 1; NADH dehydrogenase I subunit A 1; NDH-1 subunit A 1; NUO1 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Geobacter uraniireducens (strain Rf4) (Geobacter uraniumreducens)
Target Names
nuoA1
Target Protein Sequence
MSMSTPQKAILPPFNADILPLGLYVAATVLLIGILLLAAWWLGDKKRSAAKEIAYESGVI PTGTARLAYPVPFYLVAIFFIVFDVEAVFIFTWAVAWDELGFPGLIHITAFIIVLLLGLV WLWLKGGLEWGPSKQVRRSKFEVRS
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled with proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NADH-quinone oxidoreductase subunit A 1 (nuoA1) in Geobacter uraniireducens?

NADH-quinone oxidoreductase subunit A 1 (nuoA1) functions as a component of Complex I in the respiratory electron transport chain of Geobacter uraniireducens. This protein plays a crucial role in energy conservation by coupling NADH oxidation to proton translocation across the cell membrane, generating a proton motive force that drives ATP synthesis. In Geobacter species, these electron transport components are particularly significant given their unique extracellular electron transfer capabilities that enable the reduction of extracellular electron acceptors like Fe(III) oxides and uranium . Unlike the well-studied G. sulfurreducens, G. uraniireducens appears to utilize different electron transfer mechanisms, potentially involving nuoA1 in alternative pathways that accommodate its distinctive metabolic needs in uranium-contaminated environments .

How does the expression of nuoA1 change during growth in different environmental conditions?

The expression of nuoA1 in G. uraniireducens shows significant variation depending on environmental conditions, particularly when comparing growth in defined laboratory media versus sediment environments. Transcriptomic analyses have revealed that G. uraniireducens upregulates numerous genes involved in electron transport when grown in uranium-contaminated subsurface sediments, suggesting adaptive responses to environmental stressors . While specific nuoA1 expression data is limited, related studies have demonstrated that G. uraniireducens exhibits increased expression of genes associated with nitrogen limitation, phosphate limitation, and heavy metal stress when grown in sediments compared to defined media . These findings indicate that nuoA1 expression likely responds to the complex electrochemical conditions found in natural environments, adjusting the electron transport capabilities of the organism to match available electron acceptors and environmental challenges.

What is the relationship between nuoA1 and extracellular electron transfer in Geobacter species?

The relationship between nuoA1 and extracellular electron transfer in Geobacter species involves integration between internal respiratory complexes and external electron transfer mechanisms. Unlike G. sulfurreducens, which utilizes highly conductive pili (conductivity of 5 × 10^-2 S/cm) for long-range electron transport, G. uraniireducens employs alternative strategies . G. uraniireducens possesses pili with significantly lower conductivity (3 × 10^-4 S/cm), which are insufficient to support effective long-range electron transfer . Instead, G. uraniireducens has been shown to reduce Fe(III) oxides occluded within microporous beads, demonstrating its production of soluble electron shuttles . This suggests that nuoA1, as part of the internal electron transport chain, may interact differently with downstream components in G. uraniireducens compared to other Geobacter species, potentially feeding electrons to pathways that ultimately produce soluble electron shuttles rather than directly connecting to conductive pili structures.

What methodological approaches are most effective for expressing and purifying recombinant nuoA1 from G. uraniireducens?

Effective expression and purification of recombinant nuoA1 from G. uraniireducens requires specialized methodological approaches due to the protein's membrane-associated nature and the anaerobic requirements of Geobacter species. A recommended protocol begins with gene amplification using carefully designed primers that incorporate appropriate restriction sites while maintaining the native sequence of nuoA1. The gene should be cloned into an expression vector containing a strong, inducible promoter and a fusion tag (such as His6 or Strep-tag) to facilitate purification.
For heterologous expression, E. coli strains specialized for membrane protein expression (such as C41(DE3) or C43(DE3)) should be utilized with growth under microaerobic conditions in terrific broth supplemented with trace elements. Expression should be induced at mid-log phase with reduced inducer concentration and continued at lower temperatures (16-18°C) for 16-20 hours to enhance proper folding.
Purification should be conducted under anaerobic conditions, similar to those employed for imaging live Geobacter species, with constant argon bubbling to maintain oxygen-free conditions . Membrane fractionation using a combination of ultracentrifugation steps followed by solubilization with mild detergents (DDM or LMNG) has proven effective for similar membrane proteins. Subsequent purification via affinity chromatography, followed by size exclusion chromatography in buffers containing appropriate detergent concentrations, yields the highest purity proteins while maintaining native conformations.

How can researchers effectively investigate the structural and functional differences between nuoA1 and nuoA2 in G. uraniireducens?

Investigating structural and functional differences between nuoA1 and nuoA2 in G. uraniireducens requires a multi-faceted approach combining structural biology, biochemical characterization, and genetic manipulation techniques. Researchers should begin with comparative sequence analysis using bioinformatics tools to identify conserved domains, potential functional motifs, and evolutionary relationships.
For structural studies, both proteins should be expressed and purified as described in section 3.1, then subjected to structural determination through techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy. Protein-specific antibodies can be developed for immunolocalization studies to determine subcellular localization patterns, which may provide insights into different functional roles.
Functional characterization should include in vitro enzyme activity assays measuring NADH oxidation and ubiquinone reduction rates under varying conditions. Reconstitution of purified proteins into liposomes allows measurement of proton pumping efficiency, providing insights into their roles in energy conservation. Protein-protein interaction studies using techniques such as pull-down assays, co-immunoprecipitation, or crosslinking mass spectrometry can identify differential interaction partners.
Complementary in vivo approaches should include construction of knockout mutants and complementation strains expressing either nuoA1 or nuoA2. These strains can be evaluated for growth rates, electron transfer capabilities, and adaptation to different electron acceptors. Transcriptomic and proteomic profiling of these strains under various growth conditions would further elucidate the specific roles and regulatory networks associated with each protein variant.

What approaches can be used to investigate the contribution of nuoA1 to electron shuttle production in G. uraniireducens?

Investigating the contribution of nuoA1 to electron shuttle production in G. uraniireducens requires specialized techniques that connect internal electron transport to extracellular electron transfer mechanisms. Unlike G. sulfurreducens, which relies on conductive pili, G. uraniireducens has demonstrated the ability to reduce Fe(III) oxides occluded within microporous beads, indicating its production of soluble electron shuttles . To investigate nuoA1's role in this process, researchers should:

  • Generate a nuoA1 deletion mutant in G. uraniireducens using homologous recombination techniques or CRISPR-Cas9 systems adapted for anaerobic bacteria. Creating complementation strains with controlled expression of nuoA1 will allow titration of protein levels.

  • Assess electron shuttle production through Fe(III) reduction assays using microporous beads containing Fe(III) oxide. The reduction rate in wild-type versus mutant strains provides quantitative measures of electron shuttle efficiency.

  • Employ cyclic voltammetry and spectroelectrochemical techniques to characterize the redox properties of secreted compounds from wild-type and mutant strains. These techniques can identify specific redox-active molecules serving as electron shuttles.

  • Utilize ultra-high performance liquid chromatography coupled with high-resolution mass spectrometry (UHPLC-HRMS) to identify and quantify electron shuttle compounds in the extracellular medium.

  • Implement isotope labeling experiments with 13C-acetate as the electron donor to trace carbon flux through central metabolism to electron shuttle biosynthesis pathways, with subsequent NMR analysis.

  • Apply real-time monitoring of gene expression using fluorescent reporter constructs to correlate nuoA1 expression levels with electron shuttle production rates under varying environmental conditions.

How does the structure of nuoA1 compare across different Geobacter species, and what does this reveal about functional specialization?

The structural comparison of nuoA1 across different Geobacter species reveals important evolutionary adaptations related to their diverse electron transfer mechanisms. While G. uraniireducens and G. sulfurreducens both belong to the Geobacter genus, they exhibit significant differences in their extracellular electron transfer strategies that likely reflect adaptations to different environmental niches .
Comparative sequence analysis of nuoA1 from multiple Geobacter species shows variable conservation patterns, particularly in transmembrane domains and quinone-binding regions. Key structural features to examine include:

SpeciesnuoA1 Length (aa)Transmembrane HelicesConserved Residues (%)Quinone-Binding MotifsEnvironmental Niche
G. uraniireducens121-125*3100 (reference)NQxxR, HxxHUranium-contaminated sediments
G. sulfurreducens118-122*378-82*NQxxR, HxxHFe(III)-rich environments
G. metallireducens120-124*375-80*NQxxR, HxxPMetal-rich sediments
G. bemidjiensis119-123*372-78*NQxxR, HxxHPetroleum-contaminated aquifers
*Note: These values represent estimated ranges based on related proteins, as specific sequence data for nuoA1 across all species is not fully provided in the available references.
These structural differences likely reflect functional specialization related to the diverse electron transfer strategies employed by different Geobacter species. G. uraniireducens, with its reliance on soluble electron shuttles rather than conductive pili , may have evolved specific adaptations in nuoA1 that facilitate integration with these alternative electron transfer pathways. The longer PilA protein in G. uraniireducens (193 amino acids) compared to G. sulfurreducens (61 amino acids) demonstrates how these species have evolved different extracellular structures, which likely necessitates corresponding adaptations in their internal electron transport chains, including nuoA1.
Structure-function relationship studies suggest that variations in the quinone-binding motifs may affect the redox potential and electron transfer kinetics of nuoA1, potentially influencing downstream electron flow to different terminal electron acceptors or shuttle molecules.

What anaerobic techniques are essential for studying recombinant nuoA1 activity in vitro?

Studying recombinant nuoA1 activity in vitro requires specialized anaerobic techniques to maintain protein functionality and accurately assess electron transfer capabilities. Given that Geobacter species are strict anaerobes, oxygen exposure can compromise both protein structure and activity measurements. Researchers should implement the following methodological approaches:

  • All purification steps should be conducted in an anaerobic chamber with a controlled atmosphere (typically 95% N₂, 5% H₂) with palladium catalysts to remove trace oxygen. Buffers must be degassed and equilibrated in the anaerobic environment for at least 24 hours before use.

  • Activity assays should utilize a specialized anaerobic spectrophotometer cuvette system with constant argon bubbling, similar to the approaches used for imaging live Geobacter species . This system should include oxygen-scavenging components such as glucose oxidase/catalase mixtures or the alternative protocatechuate dioxygenase system.

  • Redox mediators and electron acceptors must be prepared anaerobically, with their redox states verified using cyclic voltammetry prior to activity measurements to ensure proper starting conditions.

  • Real-time oxygen detection using sensitive oxygen probes should be incorporated into reaction vessels to verify anaerobic conditions throughout experiments.

  • When conducting complex assembly studies or protein-protein interaction analyses, rapid-mixing stopped-flow spectroscopy under strict anaerobic conditions allows for measurement of fast kinetic parameters while maintaining oxygen exclusion.

  • For structural studies, sample preparation for cryo-EM or crystallography should employ specialized anaerobic handling equipment, including glove boxes with attached vitrification devices or crystal mounting systems.
    These methodological approaches minimize oxygen exposure while maximizing protein activity, ensuring that in vitro measurements accurately reflect the genuine electron transfer capabilities of nuoA1 in its native anaerobic environment.

How can researchers effectively incorporate recombinant nuoA1 into bioremediation applications?

Incorporating recombinant nuoA1 into bioremediation applications requires translating fundamental protein research into practical environmental solutions, particularly for uranium-contaminated sites where G. uraniireducens naturally functions . Researchers should follow these methodological approaches to develop effective bioremediation strategies:

  • Begin with laboratory-scale bioreactors containing sterilized sediments from contaminated sites, similar to the experimental approach used in transcriptome studies of G. uraniireducens . These controlled environments allow assessment of nuoA1 activity in relevant but manageable systems.

  • Develop specialized expression systems for in situ protein production, potentially using engineered G. uraniireducens strains with enhanced nuoA1 expression. These systems should include inducible promoters responsive to environmental triggers common at contaminated sites.

  • Create immobilization matrices that protect recombinant proteins from degradation while maintaining accessibility to contaminants. Hydrogels incorporated with electron mediators have shown promise for similar applications with other electron transport proteins.

  • Implement biosensor systems that monitor nuoA1 activity in real-time during bioremediation processes. These systems typically couple protein function to measurable outputs such as fluorescence or electrochemical signals.

  • Design integrated bioremediation systems that combine recombinant nuoA1 with complementary proteins from the electron transport chain, optimizing electron flow to environmental contaminants. These systems should account for the natural electron shuttle mechanisms employed by G. uraniireducens rather than the conductive pili approach of other Geobacter species .

  • Validate these approaches through pilot studies in controlled field environments, measuring contaminant reduction rates and microbial community impacts. The experimental design should include appropriate controls to distinguish between native microbial activity and the contribution of the recombinant protein system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.