Recombinant Geobacter uraniireducens NADH-quinone oxidoreductase subunit A 2 (nuoA2)

Shipped with Ice Packs
In Stock

Description

Introduction to Geobacter uraniireducens and nuoA2

Geobacter uraniireducens (more recently reclassified as Geotalea uraniireducens) is a gram-negative, rod-shaped, anaerobic, chemolithotrophic, mesophilic, and motile bacterium belonging to the Geobacteraceae family . This microorganism has gained significant scientific attention due to its remarkable ability to reduce iron and uranium in sediment and soil, making it a promising candidate for bioremediation of uranium-contaminated environments . G. uraniireducens was originally isolated from subsurface sediment at a former uranium ore processing facility in Rifle, Colorado, during a field study focused on uranium bioremediation .

NADH-quinone oxidoreductase subunit A 2 (nuoA2) is a critical protein component of the respiratory chain in G. uraniireducens. This protein is encoded by the nuoA2 gene (also known as Gura_4244) and functions as part of the NADH dehydrogenase I complex . The recombinant version of this protein has been produced with an N-terminal histidine tag to facilitate purification and research applications .

Comparative Sequence Analysis

When comparing the nuoA2 amino acid sequence from G. uraniireducens with its homolog in Geobacter metallireducens, we observe high conservation with subtle variations:

SpeciesAmino Acid Sequence
G. uraniireducensMLGAYLPIIVLVVVAVLFGCGSLIFSSLIGQKKPSVVKMAPYECGCEPVGSARERFSIKFYIIAMLFILFDIEAVFLYPWAVLFKRLGMFGLMEMGVFIVILFVGYIYVWKKGALEWE
G. metallireducensMLGAYLPILVLVAIAVIFGLCSLVFSSLIGQKKPSVVKLAPYECGCEPVGSARERFSVKFYIIAMLFILFDIEAVFLYPWSVLFKRLGMFGVMEMGVFIVILFVGYIYVWKKGALEWE

The differences in amino acid sequence (highlighted by the variations in residues) suggest species-specific adaptations that may correlate with the unique metabolic capabilities of each organism .

Expression System and Purification

The recombinant G. uraniireducens nuoA2 protein (UniProt ID: A5G9B9) is produced using Escherichia coli as an expression host . The full-length protein (amino acids 1-118) is fused to an N-terminal histidine tag, which facilitates protein purification through affinity chromatography methods . This expression system enables the production of substantial quantities of the protein for research purposes.

Role in Respiratory Chain

As a component of the NADH dehydrogenase I complex (also known as Complex I or NDH-1), nuoA2 likely plays a crucial role in the respiratory electron transport chain of G. uraniireducens . This complex typically catalyzes the transfer of electrons from NADH to quinones, contributing to the generation of a proton gradient across the membrane that drives ATP synthesis.

Gene Expression Under Environmental Stress

Research on G. uraniireducens grown in uranium-contaminated sediments indicates substantial upregulation of genes involved in electron transport and metal reduction . Whole-genome microarray analysis revealed 1,084 genes with elevated transcript levels during growth in sediments compared to defined culture medium . While nuoA2 is not specifically mentioned among the upregulated genes, 34 c-type cytochrome genes showed increased expression, indicating the importance of respiratory chain components in the organism's adaptation to sediment environments .

Homology with Other Geobacter Species

The nuoA2 protein from G. uraniireducens shares significant sequence homology with its counterpart in G. metallireducens (UniProt ID: Q39QA7), suggesting evolutionary conservation of this important respiratory chain component across the Geobacter genus . Both proteins have identical length (118 amino acids) and highly similar sequences, indicating shared functional roles in their respective organisms.

NADH Dehydrogenase Complex Diversity

The presence of "2" in the nuoA2 designation suggests that G. uraniireducens may possess multiple variants of the NADH dehydrogenase complex, potentially allowing for metabolic flexibility under different environmental conditions. This diversification could contribute to the organism's ability to adapt to the challenging conditions of uranium-contaminated environments.

Bioremediation Studies

The recombinant nuoA2 protein serves as a valuable tool for investigating the metabolic machinery that enables G. uraniireducens to perform uranium bioremediation . By studying the structure and function of components like nuoA2, researchers can better understand the electron transport mechanisms that facilitate the reduction of soluble U(VI) to insoluble U(IV), which is fundamental to uranium immobilization in contaminated groundwater.

Protein-Protein Interaction Studies

The availability of purified recombinant nuoA2 protein enables researchers to conduct interaction studies with other components of the respiratory chain, potentially elucidating the molecular details of electron transfer in G. uraniireducens. Such studies could reveal how this organism achieves its remarkable metal-reducing capabilities.

Antibody Production and Localization Studies

Recombinant nuoA2 can be used to generate specific antibodies for immunolocalization studies, helping researchers determine the spatial organization of respiratory complexes within G. uraniireducens cells. This information would contribute to our understanding of how the bacterium's membrane architecture supports its unique electron transport capabilities.

Reconstitution Guidelines

For optimal results when working with recombinant G. uraniireducens nuoA2, researchers should follow these reconstitution guidelines:

  1. Briefly centrifuge the vial prior to opening to bring contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (50% recommended) for long-term storage

  4. Aliquot the reconstituted protein to minimize freeze-thaw cycles

Experimental Limitations

As with any recombinant protein, researchers should be aware that the addition of the histidine tag may influence protein folding, activity, or interaction capabilities. Additionally, the E. coli expression system may not replicate all post-translational modifications that might occur in the native organism.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
nuoA2; Gura_4244; NADH-quinone oxidoreductase subunit A 2; NADH dehydrogenase I subunit A 2; NDH-1 subunit A 2; NUO1 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Geobacter uraniireducens (strain Rf4) (Geobacter uraniumreducens)
Target Names
nuoA2
Target Protein Sequence
MLGAYLPIIVLVVVAVLFGCGSLIFSSLIGQKKPSVVKMAPYECGCEPVGSARERFSIKF YIIAMLFILFDIEAVFLYPWAVLFKRLGMFGLMEMGVFIVILFVGYIYVWKKGALEWE
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transport from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction with proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), thus conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of NADH-quinone oxidoreductase in Geobacter uraniireducens?

NADH-quinone oxidoreductase (Nuo) in G. uraniireducens functions as a critical component of the electron transport chain, catalyzing electron transfer from NADH to quinones while contributing to the generation of a proton gradient for ATP synthesis. This enzyme plays a vital role in energy metabolism under anaerobic conditions, particularly in environments where G. uraniireducens participates in bioremediation processes, such as uranium-contaminated groundwater sites. The nuoA2 subunit specifically contributes to the stability and assembly of the larger Nuo complex, which is essential for cellular respiration and energy conservation in this microorganism .

How does the expression of nuoA2 change under oxidative stress conditions?

Under oxidative stress conditions, G. uraniireducens demonstrates significant transcriptional changes in genes associated with electron transport and energy metabolism. While specific nuoA2 expression data is limited, research on related Geobacter species provides valuable insights. When G. uraniireducens was exposed to 5% oxygen for 8 hours, there was a significant increase in genes associated with oxygen respiration and oxidative stress response, including components of the electron transport chain . This suggests that nuoA2, as part of the NADH-quinone oxidoreductase complex, likely undergoes modulated expression to adapt to oxygen exposure. The cellular response includes upregulation of oxidative stress genes (such as cydA and sodA) while downregulating anaerobic respiration genes, indicating a complex regulatory network that balances energy generation and oxidative damage prevention .

What are the optimal conditions for expressing recombinant G. uraniireducens nuoA2 in E. coli?

For optimal expression of recombinant G. uraniireducens nuoA2 in E. coli, researchers should consider the following protocol:

  • Vector Selection: Use a pET expression system (such as pET24b) with a His-tag fusion for efficient purification.

  • E. coli Strain: BL21(DE3) or similar strains optimized for protein expression.

  • Expression System: The Autoinduction system has proven effective for expression of Geobacter proteins, eliminating the need for monitoring cell density and manual IPTG induction .

  • Culture Conditions:

    • Temperature: 30°C for initial growth, reduced to 25°C post-induction

    • Media: Autoinduction media supplemented with appropriate antibiotics

    • Duration: 16-24 hours for complete expression

The resulting expression yields His-tagged nuoA2 protein that can be subsequently purified via affinity chromatography . Following expression, cells should be harvested by centrifugation (5,000 × g, 10 min, 4°C) and can be stored at -80°C until purification.

What purification strategy yields the highest purity nuoA2 protein for structural studies?

A multi-step purification approach is recommended to obtain high-purity nuoA2 suitable for structural studies:

Step 1: Initial Extraction and Clarification

  • Resuspend cell pellets in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM DTT, with protease inhibitors)

  • Lyse cells using sonication or cell disruption systems

  • Clarify lysate by ultracentrifugation (100,000 × g, 1 hour, 4°C)

Step 2: Affinity Chromatography

  • Apply clarified lysate to Ni-NTA resin equilibrated with binding buffer

  • Wash extensively with wash buffer containing 20-30 mM imidazole

  • Elute with a gradient or step-wise increase to 250-300 mM imidazole

Step 3: Size Exclusion Chromatography

  • Further purify eluted protein using Superdex 75 or similar column

  • Use buffer compatible with subsequent structural studies (typically 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM DTT)

Step 4: Final Concentration

  • Concentrate protein using centrifugal filters (appropriate molecular weight cutoff)

  • Verify purity by SDS-PAGE (>95% purity required for structural studies)

  • Assess protein quality by dynamic light scattering to ensure monodispersity

This approach has been successfully applied to related proteins from Geobacter species and can be adapted for nuoA2 purification . The purified protein can be stored as a lyophilized powder or in solution with 10% glycerol at -80°C.

What assays can effectively measure nuoA2 activity in vitro?

While nuoA2 alone is not catalytically active as it functions as part of the larger NADH-quinone oxidoreductase complex, several approaches can be used to assess its functional incorporation:

1. Reconstitution Assays:

  • Combine purified nuoA2 with other purified Nuo subunits under controlled conditions

  • Measure NADH:ubiquinone oxidoreductase activity using spectrophotometric assays

  • Monitor NADH oxidation by following absorbance decrease at 340 nm

2. Protein-Protein Interaction Assays:

  • Employ pull-down assays to verify interactions with other Nuo subunits

  • Use surface plasmon resonance to quantify binding kinetics

  • Apply crosslinking techniques followed by mass spectrometry to map interaction interfaces

3. Membrane Incorporation Studies:

  • Reconstitute into proteoliposomes with other Nuo subunits

  • Measure proton pumping using pH-sensitive fluorescent dyes

  • Assess membrane potential generation using voltage-sensitive probes

These methodological approaches should be complemented with appropriate controls, including known inhibitors of NADH:ubiquinone oxidoreductase activity such as rotenone and pyridaben . The integration of multiple assays provides robust assessment of nuoA2's contribution to complex I function.

How can researchers utilize nuoA2 to enhance understanding of electron transport in bioremediation processes?

Researchers can leverage nuoA2 for enhanced understanding of bioremediation processes through several methodological approaches:

Gene Expression Monitoring:

  • Develop qPCR assays targeting nuoA2 transcripts to monitor Geobacter activity in environmental samples

  • Compare expression levels across different bioremediation conditions to identify optimal parameters

  • Correlate nuoA2 expression with rates of contaminant reduction

Mutation Studies:

  • Engineer site-directed mutations in conserved regions of nuoA2 to assess impact on electron transport efficiency

  • Develop strains with modified nuoA2 expression to evaluate effects on bioremediation capacity

  • Use adaptive laboratory evolution approaches similar to those applied with GSU0514 in G. sulfurreducens

Protein-Level Analysis:

  • Generate antibodies against nuoA2 for immunological detection in environmental samples

  • Employ proteomics approaches to quantify nuoA2 abundance relative to other electron transport components

  • Use protein crosslinking to identify interaction partners in intact cells during active bioremediation

These approaches can elucidate the role of nuoA2 in electron transport during uranium bioremediation, potentially leading to enhanced bioremediation strategies. When analyzing field samples, researchers should correlate nuoA2 data with geochemical parameters to establish functional relationships between gene expression and contaminant transformation rates .

What role does nuoA2 play in the adaptation of Geobacter species to different electron acceptors during bioremediation?

The nuoA2 protein plays a multifaceted role in the adaptation of Geobacter species to different electron acceptors through several mechanisms:

Electron Transport Chain Remodeling:
During adaptation to different electron acceptors, Geobacter species undergo significant remodeling of their electron transport chains. The nuoA2 subunit contributes to this adaptation by facilitating adjustments in the NADH-quinone oxidoreductase complex composition and activity. Research on related Geobacter species has shown that when transitioning between electron acceptors (such as from fumarate to Fe(III)), significant changes occur in the expression of electron transport components .

Response to Environmental Oxidative Stress:
Despite Geobacter being anaerobic organisms, they frequently encounter microoxic conditions during bioremediation. The NADH-quinone oxidoreductase complex, including nuoA2, contributes to managing oxidative stress while maintaining energy conservation. Studies have demonstrated that exposure to oxygen leads to increased expression of oxidative stress response genes in G. uraniireducens, suggesting nuoA2 may be part of the cellular adaptation mechanism to these conditions .

Metabolic Flexibility:
The ability of Geobacter species to utilize different electron acceptors is linked to their metabolic flexibility. Research on G. sulfurreducens has demonstrated that single-base-pair mutations in regulatory genes can dramatically affect substrate utilization pathways . While not directly studied for nuoA2, similar regulatory mechanisms likely influence its expression and function when cells adapt to different electron acceptors during bioremediation processes.

What are the common challenges in expressing functional nuoA2 and how can they be overcome?

Researchers frequently encounter several challenges when expressing recombinant nuoA2, each requiring specific troubleshooting approaches:

Table 1: Common Expression Challenges and Solutions for nuoA2

ChallengePossible CausesTroubleshooting Approaches
Low expression yieldPoor codon optimization, toxicity to host1. Use codon-optimized synthetic gene
2. Try different E. coli strains (e.g., C41(DE3), C43(DE3))
3. Lower induction temperature to 18-20°C
4. Use tightly controlled expression systems
Inclusion body formationImproper protein folding, high expression rate1. Reduce expression temperature to 16-20°C
2. Lower inducer concentration
3. Co-express with molecular chaperones (GroEL/ES)
4. Add solubility enhancers (e.g., sorbitol, glycerol) to media
Protein instabilityProteolytic degradation, inherent instability1. Include additional protease inhibitors
2. Express as fusion with stabilizing partners (MBP, SUMO)
3. Optimize buffer conditions (pH, salt, additives)
4. Use freshly prepared samples for experiments
Improper foldingAbsence of interaction partners, oxidizing conditions1. Co-express with other Nuo subunits
2. Include reducing agents (DTT, β-mercaptoethanol)
3. Refold using controlled dialysis protocols
4. Verify structure using circular dichroism

When troubleshooting expression issues, it's advisable to test multiple conditions simultaneously using small-scale cultures before scaling up. The expression methodology used for other Geobacter proteins, such as the GSU0514 transcriptional regulator, can serve as a starting point, with the Autoinduction system showing particular promise for difficult-to-express proteins .

How can researchers differentiate between active and inactive forms of nuoA2 in experimental settings?

Differentiating between active and inactive forms of nuoA2 requires a multi-faceted analytical approach since the protein functions as part of a larger complex rather than independently:

Structural Analysis:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Limited proteolysis patterns to evaluate proper folding

  • Thermal shift assays to determine protein stability

  • Intrinsic fluorescence measurements to monitor tertiary structure

Functional Assessment:

  • Complex assembly assays to verify incorporation into the NADH-quinone oxidoreductase complex

  • Protein-protein interaction studies with other Nuo subunits using pull-down assays

  • Surface plasmon resonance to quantify binding affinity to partner proteins

  • Crosslinking studies to capture native interaction states

Comparative Analysis:

  • Side-by-side comparison with known functional variants

  • Correlation of structural parameters with functional outcomes

  • Mutational analysis of key residues and assessment of resulting activity changes

How might nuoA2 be engineered to enhance electron transfer efficiency in bioremediation applications?

Engineering nuoA2 for enhanced electron transfer efficiency represents an advanced research frontier with several promising approaches:

Strategic Mutation Approaches:
Researchers can apply directed evolution and rational design strategies targeting specific regions of nuoA2:

  • Identify conserved residues at subunit interfaces using structural models

  • Introduce mutations to strengthen protein-protein interactions within the complex

  • Apply random mutagenesis followed by selection for improved electron transfer

  • Create chimeric proteins incorporating beneficial features from homologs in other species

This approach is supported by research on G. sulfurreducens, where single-base-pair mutations in regulatory genes significantly enhanced substrate utilization .

Optimizing Redox Coupling:
Enhancing the coupling efficiency between NADH oxidation and quinone reduction:

  • Modify amino acids involved in quinone binding

  • Engineer electron transfer pathways to minimize energy losses

  • Adjust cofactor binding sites to optimize redox potential differences

  • Create variants with improved stability under oxidizing conditions

System-Level Integration:
Beyond protein-level modifications, consider whole-system approaches:

  • Co-express nuoA2 variants with compatible electron transport components

  • Design synthetic operons with optimized stoichiometry of complex components

  • Engineer regulatory elements to ensure appropriate expression under bioremediation conditions

  • Integrate with adaptive response mechanisms for environmental stressors

These engineering approaches should be guided by recent insights from studies on related systems, such as the adaptive evolution of G. sulfurreducens for enhanced lactate metabolism, which demonstrated the significant impact of single regulatory mutations . Successful engineering will require combined genetic, biochemical, and structural approaches to ensure that modifications enhance function without compromising complex assembly or stability.

What insights can be gained from comparing nuoA2 expression patterns with oxidative stress response genes in Geobacter species?

Comparative analysis of nuoA2 expression with oxidative stress response genes provides valuable insights into Geobacter's adaptation mechanisms:

Temporal Expression Dynamics:
Studies on Geobacter species have revealed complex temporal relationships between electron transport components and stress response genes. When G. uraniireducens was exposed to oxygen, significant changes occurred in the expression of genes associated with oxidative stress (cydA, sodA) and electron transport . By examining the co-expression patterns of nuoA2 with these stress response genes, researchers can identify regulatory networks that coordinate energy metabolism with oxidative stress management.

Regulatory Network Identification:
The correlation between nuoA2 expression and oxidative stress genes can reveal shared regulatory mechanisms:

  • Identify potential transcription factor binding sites in promoter regions

  • Determine if regulatory mutations (like those in GSU0514) affect both pathways

  • Map signaling cascades that coordinate electron transport with stress responses

  • Characterize the temporal sequence of gene activation following environmental changes

Metabolic State Indicators:
Expression patterns of nuoA2 relative to oxidative stress genes may serve as indicators of cellular metabolic states:

  • High expression of both may indicate adaptation to microoxic conditions

  • Differential expression could reflect specialized metabolic modes

  • Expression ratios may predict bioremediation efficiency in field settings

Table 2: Comparative Expression Patterns in Geobacter Species Under Different Conditions

ConditionnuoA2 ExpressionOxidative Stress GenesAnaerobic Respiration GenesMetabolic State Interpretation
Strictly anaerobicBaselineLowHighNormal anaerobic metabolism
5% oxygen exposure (1h)Slight increaseModerate increaseSlight decreaseEarly adaptation to oxidative stress
5% oxygen exposure (8h)Moderate increaseHigh increaseSignificant decreaseEstablished oxidative stress response
Fe(III) reductionHigher than fumarateHigher than fumarateDifferential regulationSpecialized electron transport configuration
Uranium bioremediationVariable (site-dependent)Elevated despite anaerobic conditionsMaintained activityComplex field adaptation

This comparative analysis reveals that despite the accumulation of Fe(II) in groundwater during bioremediation (suggesting anaerobic conditions), oxidative stress genes were highly expressed . This apparent contradiction suggests nuanced regulatory mechanisms where electron transport components like nuoA2 may serve dual roles in energy conservation and oxidative stress management.

What are the implications of nuoA2 research for developing alternative treatments for neurodegenerative disorders?

Research on nuoA2 and related NADH-quinone oxidoreductases has significant implications for neurodegenerative disorder treatments through several mechanisms:

Complex I Dysfunction and Neurodegeneration:
Mitochondrial complex I dysfunction has been implicated in various neurodegenerative conditions, including Parkinson's and Huntington's diseases . Understanding nuoA2's structure and function provides insights into complex I assembly and activity that may inform therapeutic strategies. While bacterial NADH-quinone oxidoreductases differ from mammalian complex I, they share fundamental electron transfer mechanisms that can illuminate dysfunction mechanisms.

Alternative Electron Transfer Systems:
Research has demonstrated that single-subunit NADH dehydrogenase from Saccharomyces cerevisiae (Ndi1) can functionally replace complex I in mammalian cells and confer resistance to complex I inhibitors like rotenone and pyridaben . This suggests potential therapeutic approaches where alternative electron transfer systems could bypass dysfunctional complex I in neurodegenerative conditions. Studies on nuoA2 may reveal structural features that could guide the development of simplified electron transfer modules with enhanced stability or activity.

Gene Therapy Approaches:
The successful expression of functional Ndi1 in dopaminergic cell lines suggests gene therapy potential for neurodegenerative disorders . Research methodologies developed for nuoA2 expression and characterization could inform similar approaches for neuron-targeted gene therapy:

  • Optimization of expression systems for neuronal environments

  • Development of delivery vectors with appropriate tropism

  • Engineering of protein variants with enhanced neuronal compatibility

  • Creation of regulatory systems for controlled expression in neural tissues

Biomarker Development:
The relationship between nuoA2 expression and oxidative stress response in Geobacter provides insights that could translate to mammalian systems:

  • Identification of coordinated expression patterns that indicate mitochondrial stress

  • Development of biomarkers for early detection of complex I dysfunction

  • Creation of screening assays for compounds that modulate complex I activity or bypass requirements

While direct therapeutic applications require bridging the evolutionary gap between bacterial and mammalian systems, the fundamental principles of electron transfer and oxidative stress management elucidated through nuoA2 research contribute valuable insights to the neurodegenerative disease field .

How can transcriptomic data on nuoA2 be integrated with metabolomic profiles to better understand Geobacter energy metabolism?

Integrating transcriptomic data on nuoA2 with metabolomic profiles requires sophisticated multi-omics approaches:

Data Integration Framework:
Researchers should implement a structured methodology that correlates gene expression with metabolite abundance:

  • Generate synchronized transcriptomic and metabolomic datasets under identical conditions

  • Apply statistical methods (e.g., sparse partial least squares regression) to identify correlations

  • Develop metabolic flux models incorporating nuoA2 expression levels

  • Validate predicted relationships through targeted experiments

Flux Balance Analysis:
By integrating nuoA2 expression data with metabolomic profiles, researchers can:

Time-Course Analysis:
Temporal integration of transcriptomics and metabolomics provides dynamic insights:

  • Track nuoA2 expression changes following environmental perturbations

  • Correlate expression changes with metabolite pool adjustments

  • Identify lag periods between transcriptional responses and metabolic shifts

  • Establish causality in regulatory networks

What computational approaches can accurately predict the structural interactions between nuoA2 and other components of the NADH-quinone oxidoreductase complex?

Advanced computational methods offer powerful tools for predicting structural interactions involving nuoA2:

Homology Modeling and Threading:

  • Generate structural models using templates from related organisms

  • Validate models using energy minimization and Ramachandran plot analysis

  • Refine models through molecular dynamics simulations

  • Assess model quality using statistical potentials and scoring functions

Protein-Protein Docking:

  • Apply rigid and flexible docking algorithms to predict subunit interactions

  • Use knowledge-based scoring functions to rank potential binding modes

  • Incorporate evolutionary conservation data to identify interface residues

  • Validate predictions using cross-linking experimental data

Molecular Dynamics Simulations:

  • Perform all-atom simulations of nuoA2 in complex with other subunits

  • Analyze trajectory data to identify stable interaction networks

  • Calculate binding free energies using enhanced sampling methods

  • Assess dynamic behavior of the complex in membrane environments

Integrative Modeling:

  • Combine data from multiple experimental sources (crosslinking, cryo-EM, SAXS)

  • Apply distance restraints derived from experimental data

  • Generate ensemble models that satisfy all experimental constraints

  • Quantify uncertainty in structural predictions

These computational approaches should incorporate findings from related systems, such as the DNA-binding studies performed with GSU0514 , adapting methodologies to the specific challenges of membrane protein complexes. The resulting structural models can guide experimental design for validation studies and provide mechanistic insights into electron transfer pathways within the complex.

How might CRISPR-Cas9 genome editing be applied to study nuoA2 function in Geobacter species?

CRISPR-Cas9 genome editing offers transformative approaches for studying nuoA2 function:

Precise Genetic Modifications:

  • Generate clean deletion mutants to assess essentiality and functional roles

  • Introduce point mutations to evaluate the importance of specific residues

  • Create fusion proteins with fluorescent or affinity tags for localization and interaction studies

  • Engineer regulated expression systems to control nuoA2 levels

Implementation Strategy:

  • Design sgRNAs targeting the nuoA2 gene region with minimal off-target effects

  • Develop appropriate delivery methods for Geobacter (e.g., electroporation protocols)

  • Include donor templates for homology-directed repair to introduce desired modifications

  • Implement counterselection strategies to isolate successful genome edits

Advanced Applications:

  • Create allelic series with graduated activity levels to assess dosage effects

  • Develop CRISPRi systems for conditional knockdown studies

  • Implement base editing for precise nucleotide substitutions without double-strand breaks

  • Establish multiplexed editing to simultaneously modify multiple components of the electron transport chain

This approach builds upon established genetic manipulation methods in Geobacter, such as the Cre-Lox system used for gene replacement studies in G. sulfurreducens , while offering enhanced precision and efficiency. Successful implementation would enable systematic functional analysis of nuoA2 in its native context, overcoming limitations of heterologous expression systems.

What potential exists for developing biosensors based on nuoA2 to monitor bioremediation processes in real-time?

Development of nuoA2-based biosensors represents an innovative frontier for real-time bioremediation monitoring:

Biosensor Design Strategies:

  • Transcriptional Reporters: Engineer promoter-reporter fusions that respond to conditions inducing nuoA2 expression

  • Protein-Based Sensors: Develop FRET-based systems using nuoA2 conformational changes

  • Whole-Cell Biosensors: Create Geobacter strains with nuoA2-linked reporter systems

  • Electrochemical Detectors: Design electrodes modified with nuoA2-based recognition elements

Implementation Considerations:

  • Sensitivity: Design sensors to detect relevant concentration ranges of target analytes

  • Specificity: Ensure selectivity for intended biomarkers of bioremediation activity

  • Durability: Develop robust systems for field deployment in groundwater environments

  • Signal Output: Create user-friendly readout systems for on-site monitoring

Potential Applications:

  • Real-time monitoring of microbial activity during uranium bioremediation

  • Assessment of bioremediation efficiency in response to amendment strategies

  • Early detection of process inhibition or failure

  • Spatial mapping of microbial activity across contaminated sites

This innovative approach builds on established knowledge of nuoA2 expression patterns under varying conditions, including its relationship with oxidative stress response genes . By correlating nuoA2 expression with bioremediation activity, these biosensors could provide valuable real-time insights into process efficiency and microbial community function, addressing a critical need in environmental remediation technologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.