Recombinant Geobacter uraniireducens NADH-quinone oxidoreductase subunit K 1 (nuoK1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Bioenergetics

nuoK1 is essential for proton-translocating NADH:quinone oxidoreductase activity, a process critical for energy generation in G. uraniireducens.

Electron Transport Mechanism

The NDH-1 complex in G. uraniireducens uses acetate as an electron donor and Fe(III) or U(VI) as acceptors . Subunit nuoK1 participates in:

  1. Electron Transfer: Shuttles electrons via iron-sulfur clusters between NADH and quinones .

  2. Proton Translocation: Couples redox reactions to proton pumping, generating a membrane potential .

Comparative Insights

While G. uraniireducens relies on riboflavin-mediated extracellular electron transfer (EET) for Fe(III) reduction , its NDH-1 complex remains central for intracellular energy production. In contrast, Geobacter sulfurreducens uses conductive pili for EET, but its NDH-1 subunits share structural homology with nuoK1 .

Research Applications and Findings

nuoK1 is pivotal for studying bacterial electron transport and redox biology.

Key Studies

Study FocusFindingsSource
NDH-1 StructureSubunit nuoK1 is critical for maintaining NDH-1 architecture; mutations disrupt electron transfer .
Complex I DistributionNDH-1 is widespread in bacteria, with conserved operon organization .
Uranium ReductionG. uraniireducens reduces U(VI) via Fe(III) oxide reduction, linked to NDH-1 activity .

Experimental Utilization

  • Purification: His-tagged nuoK1 is purified via affinity chromatography, enabling structural and functional studies .

  • Storage: Reconstituted in deionized water with glycerol (5–50%) to prevent freeze-thaw degradation .

  • Activity Assays: Used to study NADH-quinone reductase activity in vitro .

Comparative Analysis with Related Subunits

nuoK1 shares functional homology with subunits from other Geobacter species, though structural differences exist.

SpeciesnuoK1 HomologKey Differences
G. sulfurreducensnuoK1 (CSB-MP400799GEI)Partial sequence overlap; distinct EET mechanisms .
G. metallireducensnuoK1 (CSB-EP401173GEI)Similar membrane topology; varied redox partners .
E. coliNuoK (PMID: 12231169)Single-subunit NADH dehydrogenase vs. multi-subunit NDH-1 .

Production and Quality Control

nuoK1 is produced under stringent conditions to ensure bioactivity.

Production Parameters

ParameterSpecification
Expression SystemE. coli (pET vector)
TagN-terminal His-tag
Purity>90% (SDS-PAGE); confirmed via mass spectrometry
ReconstitutionSterile water + glycerol (50% final conc. recommended)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoK1; Gura_0321; NADH-quinone oxidoreductase subunit K 1; NADH dehydrogenase I subunit K 1; NDH-1 subunit K 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Geobacter uraniireducens (strain Rf4) (Geobacter uraniumreducens)
Target Names
nuoK1
Target Protein Sequence
MIVPLLHVLILAGILFVLGLTCVLVWRSNIIMMLIGIEIMLNAAMLAFVGGANRWGAADG QVFALMIIAMTSAEVSLALALVVYLHRRKKTVNADEFSDMKG
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is the presumed immediate electron acceptor. This redox reaction is coupled to proton translocation; specifically, four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K 1 (nuoK1) in Geobacter uraniireducens?

NADH-quinone oxidoreductase subunit K 1 (nuoK1) is a membrane protein component of the NADH dehydrogenase I complex (Complex I) in Geobacter uraniireducens. This 102-amino acid protein is encoded by the nuoK1 gene (Gura_0321) and functions in the respiratory chain, specifically in electron transfer from NADH to quinone. The protein plays a crucial role in energy conservation through the generation of proton motive force .

How is recombinant G. uraniireducens nuoK1 protein expressed and purified?

The expression and purification of recombinant G. uraniireducens nuoK1 involves several methodological steps:

Expression System:

  • Host organism: Escherichia coli

  • Vector: Expression vector containing N-terminal His-tag

  • Sequence: Full-length protein (1-102 amino acids)

Purification Protocol:

  • Expression in E. coli culture under appropriate induction conditions

  • Cell harvesting and lysis

  • Affinity chromatography using the N-terminal His-tag

  • Additional purification steps as needed (e.g., size exclusion chromatography)

  • Final product supplied as lyophilized powder

Reconstitution and Storage:

  • Brief centrifugation of vial before opening to bring contents to bottom

  • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

  • Addition of glycerol (5-50% final concentration, typically 50%)

  • Aliquoting for long-term storage at -20°C/-80°C

  • Working aliquots may be stored at 4°C for up to one week

This expression system yields recombinant protein with greater than 90% purity as determined by SDS-PAGE. Repeated freeze-thaw cycles should be avoided to maintain protein integrity . For membrane proteins like nuoK1, detergents may be incorporated during purification to maintain solubility and native conformation.

How does G. uraniireducens differ from other Geobacter species in electron transport mechanisms?

G. uraniireducens exhibits distinct differences in electron transport mechanisms compared to other Geobacter species, particularly G. sulfurreducens:

CharacteristicG. uraniireducensG. sulfurreducensSignificance
Pili conductivity0.3 ± 0.09 mS/cm at pH 7>100× higher conductivityFundamental difference in extracellular electron transfer strategy
Fe(III) oxide reductionRelies on electron shuttlesDirect electron transfer through piliDifferent ecological niche adaptation
Biofilm formationForms thinner biofilmsForms thicker, more conductive biofilmsImpacts performance in bioelectrochemical systems
Current productionLow current densityHigh current densityDifferent applications in microbial fuel cells
Direct interspecies electron transfer (DIET)Unable to participate in DIETCapable of DIETAffects syntrophic partnerships

These differences highlight a critical insight for researchers: phylogenetic affiliation with the genus Geobacter is not sufficient evidence to assume pili-based long-range electron transfer. G. uraniireducens likely relies on electron shuttles rather than conductive pili for extracellular electron transfer, representing an alternative evolutionary strategy for metal reduction and energy conservation .

What role does nuoK1 play in the electron transport chain of G. uraniireducens?

The nuoK1 subunit plays several crucial roles in the NADH:quinone oxidoreductase complex (Complex I) of G. uraniireducens:

  • Membrane Integration and Complex Stability:

    • The hydrophobic nature of nuoK1 contributes to anchoring the complex in the cytoplasmic membrane

    • Forms part of the membrane arm of Complex I, interacting with other membrane subunits

  • Proton Translocation:

    • Likely participates in forming the proton translocation pathway

    • Contributes to the conversion of redox energy to proton motive force

    • May undergo conformational changes during the catalytic cycle

  • Quinone Binding and Reduction:

    • May be involved in forming part of the quinone-binding site

    • Contributes to the electron transfer pathway from NADH to quinone

The energy transduction process in NADH:quinone oxidoreductase involves coordinated electron transfers coupled to conformational changes. Based on studies of similar complexes, the reaction likely proceeds through these steps:

  • NADH binds to the peripheral arm of the complex

  • Electrons are transferred through a series of redox centers

  • Quinone binds at the interface between the peripheral and membrane arms

  • Electron transfer to quinone is coupled to proton translocation through the membrane domain containing nuoK1

  • Reduced quinone (quinol) is released to the membrane

This process generates proton motive force that drives ATP synthesis and other cellular processes . While G. uraniireducens relies on different mechanisms for extracellular electron transfer compared to G. sulfurreducens, the internal electron transport chain components like nuoK1 perform conserved functions in energy metabolism.

How does the conductivity of G. uraniireducens pili impact its extracellular electron transfer capability?

The conductivity of G. uraniireducens pili significantly impacts its extracellular electron transfer (EET) capabilities, fundamentally altering its ecological strategy compared to other Geobacter species:

Experimental Conductivity Measurements:
Direct measurements using nanoelectrode arrays have shown that G. uraniireducens pili have a conductivity of 0.3 ± 0.09 mS/cm at pH 7, more than two orders of magnitude lower than G. sulfurreducens pili. The pili diameter was measured at approximately 3 nm, comparable to G. sulfurreducens pili, with current-voltage response showing linear (ohmic) behavior .

Functional Consequences:

  • Fe(III) Oxide Reduction Mechanism:
    G. uraniireducens can reduce Fe(III) oxide sequestered within microporous alginate beads only with the addition of the electron shuttle AQDS (anthraquinone-2,6-disulfonate), suggesting reliance on electron shuttling rather than direct electron transfer through pili.

  • Bioelectrochemical Performance:
    When G. uraniireducens pili genes were expressed in G. sulfurreducens (GUP strain):

    • Biofilms were thicker but produced much lower current densities (comparable to native G. uraniireducens)

    • Current density was approximately 0.077 mA/cm², significantly lower than control G. sulfurreducens strains

    • Fe(III) oxide reduction capability was substantially diminished

  • Ecological Implications:

    • Unable to participate in direct interspecies electron transfer (DIET)

    • May occupy different ecological niches than G. sulfurreducens

    • Likely evolved alternative strategies for metal reduction and energy conservation

This fundamental difference in conductivity represents distinct evolutionary adaptations within the Geobacter genus. While G. sulfurreducens evolved highly conductive pili enabling direct electron transfer to extracellular acceptors, G. uraniireducens appears to have evolved alternative mechanisms, possibly relying more on electron shuttles or other proteins for extracellular electron transfer .

How can G. uraniireducens be utilized in bioelectrochemical systems?

G. uraniireducens offers unique applications in bioelectrochemical systems (BESs), particularly through its ecological interactions with other electroactive bacteria:

Direct Applications:
While G. uraniireducens can form biofilms on anodes and directly reduce electrodes for current generation, it produces substantially lower current densities than G. sulfurreducens due to its poorly conductive pili and different extracellular electron transfer mechanisms.

Ecological Applications:
The most promising application involves utilizing G. uraniireducens in a supporting role within mixed-culture BESs:

  • Biofilm Rejuvenation Strategy:

    • Addition of G. uraniireducens to decayed G. sulfurreducens electroactive biofilms (EABs) leads to rejuvenation of the biofilms and recovery of current generation

    • Mechanism: Interspecies ecological competition suppresses prophage induction in G. sulfurreducens

    • Result: Enhanced metabolic activity of the biofilm and improved current production

  • Sustainability Enhancement:

    • Regular treatment of G. sulfurreducens EABs with G. uraniireducens can maintain long-term vitality

    • G. uraniireducens abundance gradually declines post-treatment (to <0.01%)

    • Cyclic treatment may be required for sustained performance

  • Experimental Implementation:

    • Introducing G. uraniireducens cell suspensions into established BESs with declining performance

    • Monitoring competitive dynamics through qPCR targeting species-specific primers

    • Assessing biofilm viability through Live/Dead staining and confocal microscopy

What experimental approaches can be used to study the function of nuoK1 in G. uraniireducens?

Multiple complementary experimental approaches can elucidate the function of nuoK1 in G. uraniireducens:

1. Heterologous Expression and Purification:

  • Express recombinant nuoK1 with affinity tags in E. coli

  • Purify using affinity chromatography followed by size exclusion chromatography

  • Reconstitute in lipid environments (proteoliposomes, nanodiscs) for functional studies

2. Functional Biochemical Assays:

  • NADH:quinone oxidoreductase activity measurements:

    • Spectrophotometric monitoring of NADH oxidation (340 nm)

    • Menadione reductase activity assays

    • Quinone reduction measured by HPLC

  • Membrane potential measurements:

    • Using oxonol VI (spectrophotometric at 625 minus 587 nm)

    • Fluorescent indicators like RH421 (λex = 500 nm, λem = 650 nm)

  • Fast kinetics experiments:

    • Stopped-flow spectroscopy to monitor electron transfer rates

    • Pre-steady-state kinetics to identify catalytic intermediates

3. Genetic and Expression Studies:

  • Heterologous expression systems:

    • G. uraniireducens nuoK1 expressed in G. sulfurreducens

    • Site-directed mutagenesis to identify critical residues

  • Transcriptional analysis:

    • qRT-PCR using species-specific primers designed as described in

    • RNA-seq under different electron acceptor conditions

4. Structural Biology Approaches:

  • X-ray crystallography of purified protein

  • Cryo-EM studies of the complete NADH:quinone oxidoreductase complex

  • Molecular dynamics simulations based on homologous structures

5. In situ Analysis:

  • Bioelectrochemical measurements correlating with nuoK1 expression levels

  • Monitoring protein expression during growth with different electron acceptors

  • Immunolocalization to determine subcellular distribution

6. Biophysical Characterization:

  • Electrophoretic mobility shift assays (EMSAs) to identify protein-protein interactions

  • Isothermal titration calorimetry to measure binding affinities with cofactors

  • Circular dichroism to analyze secondary structure elements

Implementation of these methods would require adaptations for the membrane protein nature of nuoK1, including appropriate detergents for extraction and stabilization. Data integration across multiple approaches would provide comprehensive insights into nuoK1's role in the electron transport chain of G. uraniireducens .

How does G. uraniireducens nuoK1 interact with other proteins in the NADH-quinone oxidoreductase complex?

While direct interaction data specific to G. uraniireducens nuoK1 is limited, we can infer likely protein-protein interactions based on structural and functional studies of homologous NADH:quinone oxidoreductase complexes:

Predicted Interaction Partners:

  • Core Membrane Subunits:

    • NuoL, NuoM, and NuoN: Form the proton translocation machinery along with NuoK

    • NuoH: Likely connects NuoK to the peripheral arm of the complex

    • NuoA, NuoJ: Other membrane subunits in close proximity based on complex architecture

  • Quinone-binding Interface:

    • NuoD and NuoB: May form part of the quinone-binding site along with NuoK

    • NuoH: Likely contributes to quinone-binding pocket formation

  • Structural Support Network:

    • Adjacent membrane subunits provide structural integrity to the membrane domain

    • Hydrophobic interactions between transmembrane helices stabilize the complex

Interaction Mechanisms:

The membrane subunits of NADH:quinone oxidoreductase, including nuoK1, likely interact through:

  • Hydrophobic interactions between transmembrane helices

  • Hydrogen bonding at the interfaces between subunits

  • Electrostatic interactions at the membrane-cytoplasm interface

  • Conformational changes during the catalytic cycle

Based on cryo-EM structures of Na+-pumping NADH-ubiquinone oxidoreductase , these interactions form part of the energy transduction pathway, coupling electron transfer from NADH to quinone with proton or sodium ion translocation across the membrane.

The energy transducing mechanism likely involves conformational changes propagated through the membrane domain, with nuoK1 playing a role in this energy coupling process. The precise interactions would need to be confirmed through experimental approaches such as crosslinking studies, co-immunoprecipitation, or high-resolution structural analysis of the G. uraniireducens complex .

What role does nuoK1 play in the ecological competition between Geobacter species?

The role of nuoK1 in ecological competition between Geobacter species must be understood within the broader context of energy metabolism and niche differentiation:

Ecological Competition Framework:

Research has demonstrated that G. uraniireducens and G. sulfurreducens exhibit competitive exclusion rather than coexistence when grown together. Quantitative measurements showed:

  • Very small niche difference (ND) of approximately 0.02, indicating significant niche overlap

  • Relative fitness difference (RFD) exceeding (1-ND)^-1, confirming competitive exclusion

This competition has significant functional consequences, including:

  • Suppression of prophage induction in G. sulfurreducens

  • Rejuvenation of decayed G. sulfurreducens electroactive biofilms

  • Recovery of current generation in bioelectrochemical systems

Contribution of nuoK1:

While nuoK1 is not directly implicated in this ecological interaction, it likely contributes through:

  • Energy Metabolism Efficiency:

    • As a component of NADH:quinone oxidoreductase, nuoK1 contributes to energy conservation

    • Differences in electron transport chain efficiency influence competitive fitness

    • The ability to harness energy from available electron donors affects growth rate and yield

  • Adaptation to Electron Acceptors:

    • G. uraniireducens and G. sulfurreducens employ different strategies for extracellular electron transfer

    • Internal electron transport chain components must interface with these extracellular mechanisms

    • nuoK1 may be optimized for the specific electron transfer strategy of G. uraniireducens

  • Metabolic Versatility:

    • The characteristics of electron transport chain components influence adaptability to changing conditions

    • Differences in nuoK1 function may contribute to the distinct metabolic capabilities of each species

The interspecies ecological competition that enables G. uraniireducens to rejuvenate G. sulfurreducens biofilms represents a fascinating example of microbial interactions with potential biotechnological applications. Understanding the specific contribution of nuoK1 to these competitive dynamics would require comparative expression studies during interspecies competition .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.