Recombinant Geobacter uraniireducens NADH-quinone oxidoreductase subunit K 2 (nuoK2)

Shipped with Ice Packs
In Stock
Cat. No.
BT2043826
Source
in vitro E.coli expression system
Synonyms
nuoK2; Gura_4234; NADH-quinone oxidoreductase subunit K 2; NADH dehydrogenase I subunit K 2; NDH-1 subunit K 2
Quick Inquiry

Description

Role in the Respiratory Chain

NDH-1, also known as Complex I, is a multi-subunit enzyme critical for energy metabolism in bacteria. Subunit K (nuoK2) is one of the 14 essential subunits in G. uraniireducens, contributing to the structural and functional integrity of the enzyme. Key roles include:

  • Electron Transfer: Facilitates the transfer of electrons from NADH to ubiquinone via a series of redox-active cofactors (e.g., FMN, Fe-S clusters) .

  • Proton Translocation: Couples redox reactions to the translocation of protons across the membrane, generating a proton gradient for ATP synthesis .

Production Protocol

  • Expression System: Typically expressed in Escherichia coli using optimized vectors for heterologous protein production .

  • Purification: Purified via affinity chromatography (e.g., His-tagged variants) .

  • Storage:

    • Short-Term: Store at 4°C for up to 1 week .

    • Long-Term: Store at -20°C or -80°C to prevent degradation .

Comparative Analysis with Related Subunits

SubunitFunctionCofactorsProton Translocation
nuoK2Structural support for electron transferNoneIndirect
nuoB/CFMN covalently bound, electron transferFMNDirect
nuoI/L/MFe-S clusters, proton translocationFe-S clustersDirect

Note: Data synthesized from general NDH-1 studies .

Gaps in Research

  • Structural Data: No high-resolution crystal or cryo-EM structures of G. uraniireducens nuoK2 are reported.

  • Functional Assays: Kinetic parameters (e.g., k<sub>cat</sub>, K<sub>m</sub>) for NADH oxidation or proton pumping remain uncharacterized.

Potential Applications

  1. Biotechnology: Utilized in microbial fuel cells to enhance electron transfer efficiency.

  2. Drug Development: Targeting NDH-1 subunits for antimicrobial agents, though specificity remains a challenge .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize developing that tag.
Synonyms
nuoK2; Gura_4234; NADH-quinone oxidoreductase subunit K 2; NADH dehydrogenase I subunit K 2; NDH-1 subunit K 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Geobacter uraniireducens (strain Rf4) (Geobacter uraniumreducens)
Target Names
nuoK2
Target Protein Sequence
MLALNNYLILSAILFSIGTIGVLVRRNAIVIFMCVEMMLNAVNLTFIAFSKYLGNIDGQI FVFFVMTVAAAEAAVGLALMIAFYKNRESIDVEDVNLMKW
Uniprot No.
A5G9A9

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this particular species, ubiquinone is thought to be the immediate electron acceptor for the enzyme. It couples the redox reaction with proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy within a proton gradient.
Database Links

KEGG: gur:Gura_4234

STRING: 351605.Gura_4234

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.