Recombinant Geobacter uraniireducens Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Introduction to Geobacter uraniireducens and Protease HtpX

Geobacter uraniireducens is a Gram-negative, rod-shaped, motile bacterium that was isolated from subsurface sediment undergoing uranium bioremediation . This microorganism has gained significant attention in environmental microbiology due to its ability to conserve energy through dissimilatory Fe(III) reduction while oxidizing acetate, a metabolic process crucial for bioremediation applications . G. uraniireducens strain Rf4T has been extensively studied as a pure culture representative of Geobacter species that predominate during in situ uranium bioremediation, particularly at sites like the uranium-contaminated aquifer in Rifle, Colorado .

Protease HtpX homolog (htpX) is a specific protein encoded by the htpX gene (Gura_1145) in G. uraniireducens . This protease belongs to a family of proteolytic enzymes that typically function in protein quality control and stress response systems. HtpX proteases generally play important roles in cell membrane protein degradation and homeostasis, particularly under stress conditions.

Physical and Chemical Properties

The commercially available recombinant version of this protein is typically produced as a lyophilized powder with high purity (greater than 90% as determined by SDS-PAGE) . Key characteristics of the recombinant protein include:

PropertyDescription
UniProt IDA5GAQ7
Gene NamehtpX
SynonymshtpX, Gura_1145, Protease HtpX homolog
Length285 amino acids (Full Length, 1-285)
FormLyophilized powder
Purity>90% (SDS-PAGE)
TagHis-tag (N-terminal)
Expression SystemE. coli

The recombinant protein is generally stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, though alternative formulations may include Tris-based buffer with 50% glycerol optimized for protein stability .

Recombinant Expression Systems

The Recombinant G. uraniireducens Protease HtpX homolog is typically expressed in Escherichia coli expression systems . This heterologous expression approach allows for large-scale production of the protein for research and commercial purposes. The protein is expressed as a fusion construct with an N-terminal histidine tag (His-tag), which facilitates purification through affinity chromatography techniques .

Physiological Context

G. uraniireducens operates in challenging subsurface environments where it faces various stressors including nutrient limitations and exposure to heavy metals . Transcriptomic analyses have revealed that when growing in sediments, G. uraniireducens shows upregulated expression of numerous genes related to stress response, including those involved in managing nitrogen limitation, phosphate limitation, and heavy metal stress .

While the specific function of HtpX protease in G. uraniireducens has not been explicitly detailed in the available research, proteases of this family typically function in protein quality control mechanisms, particularly in the degradation of misfolded or damaged membrane proteins. Given the environmental stressors faced by G. uraniireducens, HtpX likely plays a crucial role in maintaining cellular proteostasis under challenging conditions.

Relationship to Electron Transfer Mechanisms

G. uraniireducens employs distinctive mechanisms for metal reduction compared to other Geobacter species. Unlike G. sulfurreducens, which utilizes conductive pili for direct electron transfer, G. uraniireducens can reduce Fe(III) oxides occluded within microporous beads, indicating that it produces a soluble electron shuttle to facilitate Fe(III) oxide reduction .

This different approach to electron transfer may reflect adaptations to the specific environmental niches that G. uraniireducens occupies. While not directly linked to HtpX function in the available research, these unique metabolic characteristics provide important context for understanding protein function in this organism.

Bioremediation Studies

The study of G. uraniireducens proteins, including HtpX protease, has significant implications for bioremediation applications, particularly in uranium-contaminated environments. Research has demonstrated that G. uraniireducens can be effectively used in in situ uranium bioremediation, with whole-genome microarray analysis revealing important insights into the physiological state of these bacteria in subsurface sediments .

Understanding the role of specific proteins like HtpX protease in cellular stress responses could potentially enhance bioremediation strategies by optimizing bacterial survival and metabolic efficiency in contaminated environments.

Comparative Genomics and Proteomic Studies

The recombinant HtpX protease from G. uraniireducens serves as a valuable tool for comparative studies with homologous proteins from related species. Such comparisons can illuminate evolutionary relationships and functional adaptations among different Geobacter species, which despite their phylogenetic proximity, can display markedly different mechanisms for electron transfer and metal reduction .

These comparative approaches contribute to our understanding of microbial adaptation to specific environmental niches and the molecular mechanisms underlying these adaptations.

Metabolic and Physiological Differences

Different Geobacter species exhibit distinct metabolic strategies, despite their phylogenetic relatedness. For instance, while G. sulfurreducens relies heavily on conductive pili for extracellular electron transfer, G. uraniireducens appears to utilize soluble electron shuttles for Fe(III) oxide reduction . These differences reflect adaptations to specific environmental conditions and resource availability.

G. uraniireducens and G. sulfurreducens also differ in their gene expression patterns when grown in sediments versus defined culture media. In sediment-grown conditions, G. uraniireducens shows upregulation of numerous genes, including 34 c-type cytochrome genes that are homologous to cytochromes required for optimal Fe(III) and U(VI) reduction in G. sulfurreducens .

Future Research Directions

Several promising research directions could enhance our understanding of G. uraniireducens Protease HtpX homolog:

  1. Detailed structural analysis through X-ray crystallography or cryo-electron microscopy to elucidate the three-dimensional structure

  2. Functional characterization through enzymatic assays to determine substrate specificity and catalytic properties

  3. Investigation of the role of HtpX in stress response pathways specific to uranium-contaminated environments

  4. Comparative studies with HtpX homologs from other Geobacter species to understand structural and functional evolution

  5. Exploration of potential biotechnological applications, particularly in bioremediation contexts

These research directions could significantly advance our understanding of this protein's role in bacterial physiology and its potential applications in environmental biotechnology.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we can prioritize the development of a specified tag if provided during order placement.
Synonyms
htpX; Gura_1145; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Geobacter uraniireducens (strain Rf4) (Geobacter uraniumreducens)
Target Names
htpX
Target Protein Sequence
MNRLKTTLLLTCLTLLMVAMGSAIGGRSGMVFAFFMACAMNVFSYWFSDKIVLRMYGAQE ITEAENPAFYGMVRRLAVQAGLPMPRVYVIPSESPNAFATGRNPDHAAVAATQGILRILT PEELEGVMAHELSHVKNRDILISTIAATIAGAISMLGNMLQWAAIFGGGRDNDEEGGGML GGLAMAIIAPIAAMLIQMAVSRSREYLADESGARICGNPLSLANALRKLDSASRMLPMEE ARPATAHLFIVNPLTGGALLKLFSTHPPMEERIAKLEAMAYRPLR
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Protease HtpX homolog from Geobacter uraniireducens?

Protease HtpX homolog (htpX) from Geobacter uraniireducens is a full-length protein (285 amino acids) that belongs to the M48 peptidase domain family. The recombinant version is typically expressed with a His-tag in E. coli expression systems for research purposes. The protein functions as a protease, an enzyme that catalyzes the hydrolysis of peptide bonds in proteins and peptides. The amino acid sequence of this protein is: MNRLKTTLLLTCLTLLMVAMGSAIGGRSGMVFAFFMACAMNVFSYWFSDKIVLRMYGAQEITEAENPAFYGMVRRLAVQAGLPMPRVYVIPSESPNAFATGRNPDHAAVAATQGILRILTPEELEGVMAHELSHVKNRDILISTIAATIAGAISMLGNMLQWAAIFGGGRDNDEEGGGMLGGLAMAIIAPIAAMLIQMAVSRSREYLADESGARICGNPLSLANALRKLDSASRMLPMEEARPATAHLFIVNPLTGGALLKLFSTHPPMEERIAKLEAMAYRPLR .

What are the optimal storage conditions for recombinant htpX?

Recombinant htpX should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use scenarios to prevent protein degradation. Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing cycles should be avoided as they can compromise protein integrity and enzymatic activity. For storage, the protein is typically maintained in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0. For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being commonly used) before aliquoting and freezing .

How does the structure of htpX relate to its function?

The htpX protease contains an M48 peptidase domain, which is characterized as a metalloprotease. Based on structural analysis of similar proteases, the tertiary structure prediction using tools like AlphaFold3 reveals that htpX forms specific binding pockets that are crucial for its enzymatic activity. These pockets are often located in concave protein regions and are frequently associated with substrate binding events. The binding of metal ions, particularly Ca²⁺, to the recombinant protease results in the formation of the largest active pocket, which is essential for optimal catalytic activity. This structural feature explains why htpX functions as a metalloprotease, requiring metal cofactors for full enzymatic function .

How can I optimize the expression of recombinant Geobacter uraniireducens htpX in heterologous systems?

Optimizing the expression of recombinant Geobacter uraniireducens htpX requires careful consideration of several factors:

  • Expression system selection: While E. coli is commonly used for initial expression attempts , alternative hosts like Bacillus subtilis WB800N have shown significant improvements in expression levels. In one comparable study with a similar htpX protease, the recombinant expression demonstrated a 61.9-fold increase in fermentation level compared to the native protease .

  • Vector design: Consider using vectors with strong inducible promoters like those found in pHT43 plasmids. For optimal results, design primers with appropriate restriction sites (e.g., BamHI and SmaI) for efficient cloning .

  • Induction parameters: Culture the expression host to mid-log phase (OD600 ≈ 0.6–0.8) before inducing with IPTG at a final concentration of 1 mM. This timing ensures maximum protein production while minimizing the formation of inclusion bodies .

  • Post-expression handling: After expression, collect the fermentation supernatant by centrifugation and analyze protein expression via SDS-PAGE. For functional studies, ensure proper refolding conditions if the protein forms inclusion bodies .

Using these optimized parameters can significantly improve the yield and activity of recombinant htpX for subsequent research applications.

What role might htpX play in Geobacter species' ability to reduce heavy metals?

The htpX protease likely contributes to Geobacter species' remarkable ability to reduce heavy metals through several potential mechanisms:

  • Stress response regulation: As a protease, htpX may be involved in degrading misfolded or damaged proteins that accumulate during metal stress, thereby maintaining cellular homeostasis in metal-rich environments.

  • Enzyme modification: htpX could potentially process or modify enzymes involved in the electron transport chain that facilitates metal reduction.

  • Biofilm matrix maintenance: In Geobacter sulfurreducens, biofilms demonstrate enhanced uranium immobilization and reduction compared to planktonic cells. These biofilms can tolerate high and otherwise toxic concentrations (up to 5 mM) of uranium . If htpX functions similarly in G. uraniireducens, it might contribute to maintaining biofilm integrity under metal stress conditions.

  • Relationship with conductive structures: Uranium reduction in Geobacter biofilms depends significantly on the expression of conductive pili and, to a lesser extent, on the presence of the c cytochrome OmcZ in the biofilm matrix . HtpX might be involved in the correct assembly or maintenance of these conductive structures.

Research comparing wild-type and htpX knockout strains of Geobacter uraniireducens would be necessary to conclusively determine the protease's role in metal reduction pathways.

How can the tertiary structure of htpX be predicted and validated experimentally?

The tertiary structure prediction and experimental validation of htpX involve a multi-step approach:

  • In silico prediction:

  • Experimental validation:

    • Circular Dichroism (CD) spectroscopy to assess secondary structure elements

    • X-ray crystallography to determine high-resolution structure

    • Nuclear Magnetic Resonance (NMR) for solution-state structural analysis

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) to probe protein dynamics

    • Site-directed mutagenesis of predicted active site residues followed by activity assays to confirm functional predictions

  • Metal binding assessment:

    • Isothermal Titration Calorimetry (ITC) to measure binding affinities for metal ions

    • Inductively Coupled Plasma Mass Spectrometry (ICP-MS) to quantify bound metals

    • Activity assays in the presence and absence of various metals to determine cofactor requirements

By combining computational predictions with experimental validation, researchers can develop a reliable structural model of htpX that informs functional studies and potential applications.

What protocols should be followed for recombinant htpX protein reconstitution?

For optimal reconstitution of lyophilized recombinant htpX protein, follow these detailed steps:

  • Pre-reconstitution preparation:

    • Briefly centrifuge the vial containing lyophilized protein to ensure all material is at the bottom

    • Allow the vial to equilibrate to room temperature before opening to prevent moisture condensation

  • Reconstitution procedure:

    • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Gently mix by swirling or inversion rather than vortexing to prevent protein denaturation

    • Allow the solution to sit for 5-10 minutes at room temperature for complete dissolution

  • Long-term storage preparation:

    • Add glycerol to a final concentration of 50% (or between 5-50% as needed)

    • Divide into small working aliquots to avoid repeated freeze-thaw cycles

    • Flash freeze aliquots in liquid nitrogen before transferring to -20°C/-80°C for long-term storage

  • Quality control:

    • Verify protein concentration using Bradford or BCA assay

    • Confirm protein integrity via SDS-PAGE

    • Validate enzymatic activity using appropriate substrate assays

Following this protocol will ensure maximum retention of protein activity and stability for subsequent experiments.

How can I assess the proteolytic activity of recombinant htpX?

Assessment of htpX proteolytic activity can be performed using the following methodological approaches:

  • Spectrophotometric assays:

    • Utilize chromogenic substrates that release detectable compounds upon cleavage

    • Monitor the increase in absorbance at specific wavelengths over time

    • Calculate enzyme kinetics parameters (Km, Vmax, kcat) from the resulting data

  • Fluorescence-based methods:

    • Employ FRET (Förster Resonance Energy Transfer) peptide substrates

    • Measure the increase in fluorescence as the substrate is cleaved

    • This method offers higher sensitivity than spectrophotometric approaches

  • Zymography:

    • Perform non-reducing SDS-PAGE with gelatin or casein incorporated into the gel

    • After electrophoresis, remove SDS through washing and incubate the gel in reaction buffer

    • Stain with Coomassie Blue to visualize clear zones of proteolysis against a blue background

  • Activity under various conditions:

    • Test activity across pH ranges (typically pH 5-10)

    • Evaluate temperature stability and optimal reaction temperature

    • Assess the effects of various metal ions (particularly Ca²⁺) on enzymatic activity

    • Determine inhibitor profiles using specific protease inhibitors

A comprehensive approach would combine multiple methods to fully characterize the enzyme's activity profile and specificity.

What techniques can be used to study the role of htpX in bacterial stress response?

To investigate htpX's role in bacterial stress response, implement these research approaches:

  • Gene knockout and complementation studies:

    • Create htpX deletion mutants using CRISPR-Cas9 or homologous recombination

    • Complement the deletion with wild-type or site-directed mutant versions

    • Compare growth rates and survival under various stress conditions

  • Transcriptomics and proteomics:

    • Use RNA-seq to analyze transcriptional changes in wild-type vs. htpX mutants

    • Employ quantitative proteomics (LC-MS/MS) to identify proteins affected by htpX deletion

    • Perform these analyses under normal and stress conditions (heat, oxidative, metal exposure)

  • Protein-protein interaction studies:

    • Conduct pull-down assays using His-tagged htpX to identify binding partners

    • Use bacterial two-hybrid systems to confirm direct interactions

    • Perform co-immunoprecipitation followed by mass spectrometry to identify complexes

  • Functional assays under stress conditions:

    • Monitor biofilm formation capacity in the presence of heavy metals

    • Assess metal reduction activity comparing wild-type and htpX mutants

    • Measure membrane integrity and cell viability under stress conditions

These methodologies, when applied systematically, will provide comprehensive insights into htpX's role in mediating bacterial stress responses, particularly in metal-rich environments.

How should enzymatic data for htpX be analyzed and presented?

For rigorous analysis and clear presentation of htpX enzymatic data, follow these guidelines:

  • Kinetic parameter determination:

    • Calculate Km, Vmax, and kcat using appropriate enzyme kinetics software

    • Present data in tabular format with standard errors, as shown below:

    Kinetic ParameterValueStandard ErrorExperimental Conditions
    Km (μM)X.XX±X.XXpH X.X, XX°C
    Vmax (μmol/min/mg)X.XX±X.XXpH X.X, XX°C
    kcat (s-1)X.XX±X.XXpH X.X, XX°C
    kcat/Km (M-1 s-1)X.XX±X.XXpH X.X, XX°C
  • pH and temperature profiles:

    • Plot relative activity (%) against pH and temperature

    • Use non-linear regression to fit appropriate curves

    • Include error bars representing standard deviation from triplicate experiments

    • Determine and clearly indicate optimal pH and temperature conditions

  • Metal ion and inhibitor effects:

    • Present as a bar graph showing relative activity (%) with different additives

    • Include statistical analysis (ANOVA with post-hoc tests) to determine significant differences

    • Organize compounds by their effect (activators, inhibitors, no effect)

  • Statistical considerations:

    • Ensure all experiments are conducted in at least triplicate

    • Report results as mean value ± standard deviation

    • Use appropriate statistical tests (t-test, ANOVA) to determine significance

    • Generate publication-quality graphs using software like Origin 2021

This structured approach to data analysis ensures scientific rigor and facilitates meaningful interpretation of htpX enzymatic properties.

What should be considered when interpreting htpX's role in uranium bioremediation studies?

When interpreting htpX's potential role in uranium bioremediation studies, consider these critical factors:

  • Contextual integration with known mechanisms:

    • Biofilms of Geobacter species immobilize substantially more U(VI) than planktonic cells and do so for longer periods

    • They reductively precipitate uranium to a mononuclear U(IV) phase involving carbon ligands

    • Biofilms can tolerate high and otherwise toxic concentrations (up to 5 mM) of uranium

    • The enhanced uranium immobilization correlates with:
      a) Biofilm area exposed to the contaminant
      b) Expression of conductive pili
      c) Presence of cytochrome OmcZ in the biofilm matrix

  • Experimental design considerations:

    • Control for variation in cell density and growth phase

    • Standardize uranium exposure conditions (concentration, time, media composition)

    • Consider the influence of experimental setup on biofilm formation

  • Data integration framework:

    • Correlate proteolytic activity with uranium reduction rates

    • Analyze gene expression patterns in response to uranium exposure

    • Consider post-translational modifications affecting htpX function

  • Technical limitations awareness:

    • Acknowledge differences between laboratory and field conditions

    • Consider matrix effects in environmental samples

    • Address potential confounding factors from mixed microbial communities

By systematically addressing these considerations, researchers can develop more accurate models of htpX's contribution to uranium bioremediation processes.

What are promising applications for htpX in environmental bioremediation?

Based on current knowledge and research gaps, several promising applications for htpX in environmental bioremediation warrant further investigation:

  • Engineered biofilm-based systems:

    • Development of engineered biofilms with optimized htpX expression for enhanced heavy metal immobilization

    • Creation of permeable biobarriers incorporating Geobacter species for in situ treatment of uranium-contaminated groundwater

    • Design of biofilm-based reactors for ex situ treatment of metal-contaminated wastewaters

  • Protein engineering approaches:

    • Rational design of htpX variants with enhanced stability in environmental conditions

    • Directed evolution to improve metal tolerance and reduction capacity

    • Development of fusion proteins combining htpX with metal-binding domains for enhanced remediation efficiency

  • Integration with other remediation technologies:

    • Coupling htpX-based bioremediation with electrokinetic approaches

    • Combining with phytoremediation strategies for comprehensive site cleanup

    • Integration with nanomaterial-based technologies for synergistic remediation effects

The implementation of these research directions could significantly advance the application of htpX and related proteins in addressing environmental contamination issues, particularly in uranium-impacted sites.

How might understanding htpX structure-function relationships lead to novel biotechnological applications?

Elucidating htpX structure-function relationships could unlock various biotechnological applications beyond environmental remediation:

  • Catalyst development:

    • Engineering htpX variants as biocatalysts for industrial processes

    • Developing immobilized enzyme systems for continuous bioprocessing

    • Creating chimeric enzymes with novel catalytic properties

  • Biosensor development:

    • Utilizing structure-informed protein engineering to create metal-sensing proteins

    • Developing real-time monitoring systems for environmental metal contamination

    • Creating biosensors for detecting proteolytic activity in various matrices

  • Therapeutic applications:

    • Understanding metalloprotease mechanisms for pharmaceutical development

    • Exploring antimicrobial applications targeting bacterial proteases

    • Investigating protein degradation pathways relevant to human disease

  • Synthetic biology platforms:

    • Incorporating htpX into synthetic circuits for programmable protein degradation

    • Creating cellular stress response modules for biotechnology applications

    • Developing tunable protein expression systems regulated by proteolytic activity

Each of these directions represents a promising avenue for translating fundamental knowledge about htpX structure and function into practical biotechnological solutions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.