Recombinant Gerbillurus vallinus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a particular tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Gerbillurus vallinus (Brush-tailed hairy-footed gerbil)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELTNFHDHTLMIVFLISSLVLYLISLMLTTKLIHTNTMDAQE VETVWTILPAIILIMIALPSLRILYLMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMTPTNELKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATITSNRPGVFYGQCSEICGSNHSFMPIVLEMIPLKLFENWSTSMI
Uniprot No.

Target Background

Function
Recombinant Gerbillurus vallinus Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the CuA center of subunit 2 and heme A of subunit 1 to the active site in subunit 1 – a binuclear center (BNC) composed of heme A3 and CuB. The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Gerbillurus vallinus Cytochrome c oxidase subunit 2?

Cytochrome c oxidase subunit 2 (MT-CO2) is a core subunit of mitochondrial Cytochrome c oxidase (CCO), containing a dual core CuA active site that plays a significant role in physiological processes. In Gerbillurus vallinus, this protein consists of 227 amino acid residues and functions as part of the electron transport chain in cellular respiration. The protein is also known by alternative names including Cytochrome c oxidase polypeptide II, with gene synonyms including COII, COXII, and MTCO2 .

MT-CO2 is an oligomeric enzyme that catalyzes the oxidation of its substrate Cytochrome C. This protein is encoded in the mitochondrial genome, making it valuable for evolutionary studies and phylogenetic analysis of rodent species, particularly within the Gerbillinae subfamily .

What are the optimal storage conditions for recombinant MT-CO2?

For optimal stability and activity maintenance of recombinant Gerbillurus vallinus MT-CO2, the following storage conditions are recommended:

  • Store at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • Use a storage buffer consisting of Tris-based buffer with 50% glycerol, optimized for this protein

  • Avoid repeated freezing and thawing cycles, as this may compromise protein integrity

  • Store working aliquots at 4°C for up to one week

These storage recommendations are similar to those for other recombinant cytochrome c oxidase proteins, which generally require protection from denaturation through the inclusion of glycerol in storage buffers.

How can hydrophobicity and antigenicity profiles be analyzed for Gerbillurus vallinus MT-CO2?

Analysis of hydrophobicity and antigenicity profiles for Gerbillurus vallinus MT-CO2 requires a multi-method approach to ensure reliable results:

Hydrophobicity Analysis Methods:

  • Kyte and Doolittle scale analysis to identify hydrophobic regions

  • Bull and Breese method for characterizing amino acid polarity

  • Miyazawa scale for identifying residues involved in protein folding

  • Wilson et al. and Cowan methods for comprehensive hydrophobic characterization

Antigenicity Prediction Methods:

  • Hopp and Woods algorithm to identify regions of maximal hydrophilicity (likely antigenic sites)

  • Welling method to assess antigenicity based on amino acid occurrence in known epitopes

  • Parker method for identifying potentially antigenic regions

  • Bepipred for linear B-cell epitope prediction

  • Kolaskar and Tongaonkar antigenicity assessment to identify antigenic determinants

Research has shown that the regions of maximal hydrophilicity in MT-CO2 are likely to be antigenic sites, largely due to their hydrophobic characteristics. Terminal regions are particularly important as they tend to be solvent accessible and unstructured, making antibodies against these regions likely to recognize the native protein .

What experimental approaches are recommended for expression and purification of recombinant MT-CO2?

For optimal expression and purification of recombinant Gerbillurus vallinus MT-CO2, the following experimental approach is recommended:

Expression System Setup:

  • Subclone the full-length MT-CO2 gene into an appropriate expression vector (such as pET-32a)

  • Transform the recombinant plasmid into E. coli expression system (Transetta DE3 or similar)

  • Induce protein expression using isopropyl β-d-thiogalactopyranoside (IPTG)

Purification Protocol:

  • Harvest and lyse bacterial cells containing expressed protein

  • Implement affinity chromatography with Ni²⁺-NTA agarose for His-tagged protein

  • Verify purification using SDS-PAGE and Western Blotting (WB)

  • Confirm protein identity through mass spectrometry analysis

  • Assess protein concentration using standard methods such as Bradford assay

Based on similar cytochrome c oxidase subunit II proteins, the expected molecular mass of the recombinant protein with tags would be approximately 44 kDa, with purified protein concentrations typically around 50 μg/mL .

How can functional activity of recombinant MT-CO2 be assessed?

Functional assessment of recombinant Gerbillurus vallinus MT-CO2 should include:

Enzyme Activity Assays:

  • UV-spectrophotometer analysis to measure oxidation rate of Cytochrome C substrate

  • Kinetic analysis to determine Km and Vmax values

  • pH and temperature optimum determination

  • Effect of inhibitors or modulators (such as allyl isothiocyanate) on enzyme activity

Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure

  • Infrared spectroscopy to analyze protein conformational states

  • Mass spectrometry for verification of post-translational modifications

A functional recombinant MT-CO2 should effectively catalyze the oxidation of its substrate Cytochrome C. The catalytic activity can be quantified by measuring electron transfer rates using spectrophotometric methods. For comprehensive analysis, molecular docking methods can also be employed to investigate potential binding sites for substrates or inhibitors .

How can Gerbillurus vallinus MT-CO2 be utilized in phylogenetic studies?

Gerbillurus vallinus MT-CO2 represents an important molecular marker for phylogenetic analysis of rodents, particularly within the Gerbillinae subfamily. The following methodological approach is recommended:

DNA Sequencing and Analysis Protocol:

  • Extract total genomic DNA using standard phenol-chloroform-isoamyl alcohol extraction procedures

  • Amplify MT-CO2 gene using PCR with specific primers

  • Conduct sequencing of approximately 684 bp of MT-CO2

Phylogenetic Analysis:

  • Align MT-CO2 sequences with those from other species using MUSCLE or similar alignment software

  • Conduct Bayesian inference analysis using MrBayes or BEAST

  • Implement maximum-likelihood analysis using RAxML

  • Assess node support through posterior probabilities and bootstrap values

  • Estimate divergence times using relaxed molecular clock models

Analysis ComponentRecommended Parameters
Alignment methodMUSCLE with default parameters
Bayesian analysis4 independent MC³ chains, 10⁷ generations
Clock modelUncorrelated lognormal relaxed-clock
Effective sample size>600 for individual runs, >3000 for combined chains
Tree summarizationMaximum-clade credibility tree criterion

MT-CO2 sequences have proven valuable in resolving phylogenetic relationships among gerbils and related rodents, often revealing discordances between molecular and morphological phylogenies .

What challenges might researchers encounter when working with recombinant MT-CO2 and how can they be addressed?

Researchers working with recombinant Gerbillurus vallinus MT-CO2 may encounter several challenges:

Solubility Issues:

  • Challenge: MT-CO2 contains hydrophobic regions that may cause protein aggregation

  • Solution: Optimize expression conditions with reduced induction temperature (16-20°C) and lower IPTG concentrations; include solubility enhancers like sorbitol or glycerol in culture medium; use solubility-enhancing fusion tags

Functional Activity Retention:

  • Challenge: Maintaining enzymatic activity during purification

  • Solution: Include stabilizing agents in purification buffers; minimize exposure to extreme pH or temperature; optimize elution conditions to preserve protein structure

Antigenicity Prediction Validation:

  • Challenge: Confirming in silico predictions experimentally

  • Solution: Use multiple prediction algorithms and validate through ELISA or other immunological techniques; focus on regions with consensus predictions across multiple methods

Comparative Analysis Limitations:

  • Challenge: Limited available data on Gerbillurus vallinus for comparative studies

  • Solution: Extend analysis to closely related species with better-characterized MT-CO2; implement careful sequencing verification of specimen identity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.