Recombinant Gerbillus gerbillus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction

Cytochrome c oxidase subunit 2 (MT-CO2) is a critical component of the mitochondrial respiratory chain, specifically complex IV, which catalyzes the reduction of oxygen to water . In Gerbillus gerbillus, commonly known as the Mongolian gerbil, the MT-CO2 subunit plays an essential role in cellular respiration and energy production. Recombinant MT-CO2 refers to the subunit produced through recombinant DNA technology, allowing for detailed study and manipulation of its structure and function.

Gene and Protein Structure

The MT-CO2 gene is located in the mitochondrial genome . The MT-CO2 protein contains two transmembrane regions in its N-terminus, with the major part of the protein exposed to the mitochondrial intermembrane space . This subunit is crucial for the transfer of electrons from cytochrome c to the bimetallic center of catalytic subunit 1, utilizing its binuclear copper A center .

Function and Mechanism

MT-CO2 provides the substrate-binding site and contains the binuclear copper A center, which serves as the primary electron acceptor in cytochrome c oxidase . The proper functioning of MT-CO2 is essential for maintaining efficient electron transport and energy production within the mitochondria.

Role in Cytochrome c Oxidase

MT-CO2 is one of the three subunits responsible for forming the functional core of cytochrome c oxidase . This complex is vital for the final step in the electron transport chain, where oxygen is reduced to water, and the energy released is used to generate a proton gradient that drives ATP synthesis.

Significance of Recombinant MT-CO2

Producing recombinant MT-CO2 allows researchers to investigate its properties in isolation and in controlled environments. This is particularly useful for:

  • Structural Studies: Determining the detailed three-dimensional structure of the protein.

  • Functional Assays: Assessing the electron transfer efficiency and substrate-binding characteristics.

  • Mutation Analysis: Studying the effects of specific mutations on protein function and stability .

Research Applications

Recombinant MT-CO2 is used in various research areas to understand mitochondrial function and disease:

  • Mitochondrial Dysfunction: Investigating the role of MT-CO2 mutations in mitochondrial diseases .

  • Comparative Studies: Examining the sequence and functional variations across different species .

  • Drug Development: Screening for compounds that can modulate MT-CO2 activity .

Genetic Diversity

Genetic studies involving Gerbillus species often utilize MT-CO2 as a marker for assessing genetic diversity and phylogenetic relationships . Analyzing the sequence variations in MT-CO2 helps in understanding the evolutionary history and population structure of gerbils.

Tables and Data

Since specific data tables and research findings for recombinant Gerbillus gerbillus MT-CO2 are not available in the provided , general examples related to cytochrome c oxidase subunit II (COII) studies are included below to illustrate the type of information typically gathered.

Table 1: Primates Cytochrome c Oxidase Subunit II Gene

Primate SpeciesAmino Acid Replacement RateVariation in Amino Terminal End
Monkeys and ApesNearly two-fold increaseIncreased variation
Lower Primates (Lemurs)Slower rateGenerally conserved

Table 2: Effects of MT-CO2 Mutation on COX Activity

Mutation LoadCOX Activity
< 55-65%Normal
> 55-65%Decreased
> 95%Undetectable

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Gerbillus gerbillus (Lesser Egyptian gerbil)
Target Names
Target Protein Sequence
MAYPFQLGLQDASSPIMEELMNFHDHTLMIVFLISSLVLYLMALMLSTKLIHTSTMDAQE VETIWTILPAIILIMIALPSLRILYMMDEINNPILTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNELKPGELRLLEVDNRIVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATITSNRPGVFYGQCSEICGSNHSFMPIVLEMIPLKLFENWSMSMT
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work in concert to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the active site, a binuclear center (BNC) composed of heme A3 and CuB in subunit 1. The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO2 and what is its functional role in cellular metabolism?

MT-CO2 (Mitochondrially Encoded Cytochrome C Oxidase II) is a protein-coding gene that functions as a critical component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain. This enzyme catalyzes the reduction of oxygen to water during oxidative phosphorylation. MT-CO2 contributes to cytochrome-c oxidase activity and is involved in mitochondrial electron transport from cytochrome c to oxygen . The protein is located in the mitochondrial inner membrane as part of respiratory chain complex IV and plays an essential role in cellular energy production through ATP synthesis . In the context of Gerbillus gerbillus research, understanding this fundamental function provides the foundation for more specialized studies on species-specific adaptations in energy metabolism.

How does the structure of MT-CO2 relate to its function in the electron transport chain?

MT-CO2 forms a critical part of cytochrome c oxidase (Complex IV) where it contains the dinuclear copper A center (CU(A)) . This center receives electrons from reduced cytochrome c in the intermembrane space. These electrons are then transferred via heme A of subunit 1 to the binuclear center formed by heme A3 and copper B, which constitutes the active site . The structural arrangement of these metal centers creates an electron transfer pathway essential for oxygen reduction. The copperA center in MT-CO2 serves as the primary electron acceptor from cytochrome c, making it crucial for initiating the electron transfer process that ultimately reduces oxygen to water using 4 electrons from cytochrome c and 4 protons from the mitochondrial matrix .

What conservation patterns exist in MT-CO2 sequences across gerbil species and how might they inform evolutionary studies?

While specific comparative data for Gerbillus gerbillus MT-CO2 is not directly provided in the search results, research on gerbil genomes indicates interesting evolutionary patterns that would likely apply to MT-CO2. Gerbil genomes contain extensive sets of GC-rich genes that show clustering patterns beyond what would be expected by chance . These GC-rich genes tend to be located near recombination hotspots, suggesting that GC-biased gene conversion may drive their extreme GC content . This pattern may influence the evolution of mitochondrial genes like MT-CO2 in gerbil species. Researchers studying MT-CO2 conservation across gerbil species should consider examining whether this gene shows similar GC-content patterns and whether these patterns correlate with functional adaptations specific to desert-dwelling rodents like Gerbillus gerbillus.

What common challenges arise when expressing recombinant MT-CO2 in heterologous systems?

Expression of mitochondrially-encoded membrane proteins like MT-CO2 presents several challenges in recombinant systems. As MT-CO2 is normally encoded by the mitochondrial genome and synthesized within the organelle, expression in bacterial or other heterologous systems requires codon optimization for the host organism. Additionally, proper insertion into membranes is essential for correct folding and function of MT-CO2. Without the complete cytochrome c oxidase complex and associated assembly factors, recombinant MT-CO2 may misfold or aggregate. Researchers must carefully design expression constructs that include appropriate signal sequences and solubilizing tags to improve membrane targeting and protein solubility. Expression may also require specialized host systems capable of providing the correct redox environment and metal cofactors necessary for functional MT-CO2.

How do genomic features like GC content affect recombinant expression of MT-CO2 from Gerbillus gerbillus?

Research on gerbil genomes has revealed that many genes exhibit extreme GC content, with significant clustering of GC-rich genes near recombination hotspots . For recombinant expression of Gerbillus gerbillus MT-CO2, these genomic features have important implications. High GC content can affect mRNA secondary structure, codon usage, and translation efficiency in heterologous expression systems. When designing expression constructs for recombinant MT-CO2, researchers should consider codon optimization strategies that account for the potentially skewed GC content while maintaining amino acid sequence. The research indicates that GC-rich genes are often found near telomere repeats and recombination hotspots in gerbil genomes , suggesting that MT-CO2 may have evolved under specific selective pressures that should be considered when expressing the protein in non-native contexts.

What methods can be used to verify the structural integrity of recombinant MT-CO2 compared to native protein?

Verification of structural integrity for recombinant MT-CO2 requires multiple complementary approaches. Researchers should implement a combination of:

  • Spectroscopic analysis - Cytochrome c oxidase subunits have characteristic absorption spectra due to their heme groups. UV-visible spectroscopy can confirm proper incorporation of heme cofactors in recombinant MT-CO2.

  • Circular dichroism (CD) spectroscopy - This technique assesses secondary structure elements to verify proper folding, especially important for membrane proteins like MT-CO2.

  • Limited proteolysis - Properly folded proteins show characteristic digestion patterns when exposed to proteases, allowing comparison between native and recombinant forms.

  • Metal analysis - Since MT-CO2 contains copper centers critical for function , inductively coupled plasma mass spectrometry (ICP-MS) can verify correct metal incorporation.

  • Electron microscopy - Negative stain or cryo-EM can provide structural information to compare recombinant protein with known native structures.

  • Functional assays - Measuring electron transfer capability from cytochrome c using oxygen consumption assays or artificial electron acceptors to verify catalytic function.

How can recombination hotspots in gerbil genomes inform our understanding of MT-CO2 evolution?

The research indicates that GC-rich genes in gerbils are non-randomly distributed and frequently associated with recombination hotspots . This association suggests that recombination-associated processes, particularly GC-biased gene conversion, may drive the extreme GC content observed in some gerbil genes . For MT-CO2 evolution, these findings have significant implications. If MT-CO2 is located near a recombination hotspot, it may experience accelerated evolution through GC-biased gene conversion, potentially leading to lineage-specific adaptations. Researchers should examine whether Gerbillus gerbillus MT-CO2 shows evidence of GC bias and whether this correlates with functional adaptations. The study found that GC-rich genes are closer to telomere repeats than expected by chance , suggesting that chromosomal location influences evolutionary trajectory. Comparative analysis of MT-CO2 across gerbil species with differing chromosomal arrangements could reveal how genomic architecture shapes mitochondrial gene evolution.

What experimental approaches can distinguish between species-specific functional adaptations and neutral evolutionary changes in MT-CO2?

To distinguish between functional adaptations and neutral changes in Gerbillus gerbillus MT-CO2, researchers should implement a multi-faceted experimental approach:

  • Evolutionary rate analysis - Compare nonsynonymous to synonymous substitution rates (dN/dS) across gerbil species and identify sites under positive selection.

  • Ancestral sequence reconstruction - Synthesize predicted ancestral versions of MT-CO2 for functional comparison with modern variants.

  • Site-directed mutagenesis - Create recombinant variants with specific amino acid substitutions to test their functional consequences.

  • Enzyme kinetics - Measure and compare reaction rates, substrate affinity, and catalytic efficiency of MT-CO2 variants under varying conditions relevant to desert environments (temperature, pH, salt concentration).

  • Structural analysis - Map species-specific substitutions onto protein structure to determine whether they cluster near functional sites.

  • Cross-species complementation - Test whether Gerbillus gerbillus MT-CO2 can rescue function in cytochrome c oxidase-deficient cells from other species.

  • Environmental stress response - Compare functional parameters of MT-CO2 variants under conditions mimicking the desert environment to identify potential adaptive advantages.

What expression systems are most suitable for producing functional recombinant MT-CO2?

The optimal expression system for recombinant MT-CO2 depends on research objectives but should address the challenges of expressing a mitochondrial membrane protein. Based on current methodology for similar proteins, researchers should consider:

  • Bacterial systems (E. coli):

    • C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

    • Fusion partners such as MBP or SUMO to enhance solubility

    • Cold-shock expression protocols (16-18°C) to slow protein production and facilitate proper folding

  • Yeast systems (S. cerevisiae or P. pastoris):

    • Mitochondrial targeting sequences to direct protein to the appropriate organelle

    • Inducible promoters (GAL1 or AOX1) for controlled expression

    • Humanized or optimized codon usage considering the GC content patterns observed in gerbil genomes

  • Insect cell systems (Sf9 or High Five):

    • Baculovirus expression vectors with optimized signal sequences

    • Co-expression with other cytochrome c oxidase subunits to facilitate complex formation

  • Mammalian cell systems (HEK293 or CHO):

    • Tetracycline-inducible expression for fine control

    • Mitochondrial targeting sequences from human MT-CO2 for proper localization

Selection should consider that MT-CO2 requires specific cofactors and the oxidizing environment of the mitochondrial intermembrane space for proper folding and function.

What purification strategies yield the highest purity and activity for recombinant MT-CO2?

Purification of recombinant MT-CO2 requires specialized approaches due to its membrane-associated nature and requirement for cofactors. An effective purification strategy would include:

  • Membrane fraction isolation:

    • Differential centrifugation to isolate membrane fractions

    • Specialized buffers containing glycerol (10-15%) to stabilize membrane proteins

  • Solubilization:

    • Mild detergents (DDM, LMNG, or digitonin) at concentrations just above CMC

    • Addition of lipids (cardiolipin, phosphatidylcholine) to maintain native-like environment

  • Chromatography:

    • Initial capture using affinity chromatography via engineered tags (His, FLAG, or Strep)

    • Ion-exchange chromatography exploiting the natural charge properties of MT-CO2

    • Size-exclusion chromatography to separate properly folded protein from aggregates

  • Cofactor reconstitution:

    • Addition of copper and heme during or after purification to ensure proper incorporation

    • Verification of cofactor binding using absorption spectroscopy

  • Activity preservation:

    • Maintain reducing conditions to prevent oxidative damage

    • Include stabilizing agents (glycerol, sucrose) in storage buffers

    • Consider incorporating MT-CO2 into nanodiscs or liposomes for long-term stability

Purification success should be monitored by SDS-PAGE, Western blotting, and functional assays to ensure both purity and activity are maintained throughout the process.

How can researchers assess the functional integrity of purified recombinant MT-CO2?

Assessing functional integrity of recombinant MT-CO2 requires a combination of biochemical and biophysical techniques:

  • Electron transfer activity:

    • Polarographic oxygen consumption assays using reduced cytochrome c as electron donor

    • Spectrophotometric assays monitoring cytochrome c oxidation rates

    • Artificial electron acceptor/donor assays for partial reaction kinetics

  • Spectroscopic characterization:

    • UV-visible absorption spectroscopy to confirm proper heme incorporation

    • Resonance Raman spectroscopy to examine heme environment

    • EPR spectroscopy to analyze copper center environment and oxidation state

  • Structural integrity:

    • Circular dichroism to verify secondary structure composition

    • Thermal stability assays to determine melting temperature

    • Limited proteolysis patterns compared to native protein

  • Cofactor analysis:

    • ICP-MS for quantification of copper content

    • Pyridine hemochromagen assay for heme quantification

    • Metal-to-protein stoichiometry determination

  • Protein-protein interactions:

    • Co-immunoprecipitation with other cytochrome c oxidase subunits

    • Surface plasmon resonance to measure binding kinetics with cytochrome c

    • Crosslinking studies to verify native-like interactions

A comprehensive functional assessment would include comparing kinetic parameters (Km, Vmax, kcat) of recombinant MT-CO2 with those of the native protein isolated from Gerbillus gerbillus mitochondria.

What techniques are most effective for studying the interaction between recombinant MT-CO2 and other components of the respiratory chain?

Studying interactions between recombinant MT-CO2 and other respiratory chain components requires techniques that can capture both transient and stable interactions:

  • Co-expression and co-purification:

    • Dual-tag purification strategies to isolate intact complexes

    • Sequential purification to identify stable interaction partners

    • Mass spectrometry to identify co-purifying proteins

  • Biophysical interaction analysis:

    • Isothermal titration calorimetry (ITC) to measure binding thermodynamics

    • Surface plasmon resonance (SPR) or biolayer interferometry (BLI) for binding kinetics

    • Microscale thermophoresis for detecting interactions in near-native conditions

  • Structural approaches:

    • Cryo-electron microscopy of reconstituted complexes

    • Crosslinking mass spectrometry to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes upon binding

  • Functional coupling assays:

    • Respirometry measurements in reconstituted systems

    • Supercomplex formation analysis using blue native PAGE

    • Electron transfer kinetics between purified components

  • In-cell approaches:

    • Förster resonance energy transfer (FRET) between tagged components

    • Proximity ligation assays to detect protein-protein interactions in situ

    • Split reporter complementation assays for monitoring dynamic interactions

These approaches can elucidate how MT-CO2 from Gerbillus gerbillus might differ in its interaction properties compared to other species, potentially revealing adaptations related to desert environments.

How should researchers interpret differences in spectroscopic properties between native and recombinant MT-CO2?

Differences in spectroscopic properties between native and recombinant MT-CO2 can provide valuable insights into structural and functional aspects of the protein. When analyzing such differences, researchers should consider:

  • Absorption spectra differences:

    • Shifts in Soret band position (typically 410-420 nm) may indicate altered heme environment

    • Changes in α/β band intensity ratios can reveal differences in heme coordination

    • Appearance of additional peaks may suggest the presence of misfolded protein species

  • Circular dichroism spectra interpretation:

    • Differences in negative bands at 208 and 222 nm reflect altered α-helical content

    • Changes in the spectral region below 200 nm may indicate differences in unstructured regions

    • Temperature-dependent CD profiles can reveal differences in thermal stability

  • Fluorescence spectra analysis:

    • Tryptophan fluorescence changes may reflect differences in tertiary structure

    • Fluorescence quenching patterns can indicate changes in cofactor proximity to aromatic residues

    • Anisotropy measurements can reveal differences in protein flexibility

  • EPR spectra evaluation:

    • Changes in g-values for copper centers suggest altered electronic environment

    • Line broadening may indicate differences in conformational heterogeneity

    • Signal intensity changes can reflect differences in metallation efficiency

  • Resonance Raman interpretation:

    • Shifts in Fe-His stretching frequencies indicate changes in heme-protein interactions

    • Alterations in porphyrin vibration modes suggest modified heme pocket environment

These spectroscopic differences should be correlated with functional parameters to determine whether they represent benign variation or functionally significant changes.

What experimental controls are essential when comparing recombinant MT-CO2 with native protein in functional assays?

To ensure valid comparisons between recombinant and native MT-CO2 in functional assays, researchers must implement multiple experimental controls:

Control TypeDescriptionPurpose
Enzymatic baselineAssays with denatured or inhibited enzymeEstablishes non-enzymatic background rates
Substrate/cofactor saturationVarying concentrations of substrates and cofactorsConfirms assays are performed under saturating conditions
Buffer compositionIdentical buffer conditions for both protein preparationsEliminates buffer effects on activity differences
Detergent/lipid effectsControls with varying detergent or lipid compositionsAssesses impact of membrane environment on activity
Temperature dependenceActivity measurements at multiple temperaturesReveals potential adaptations to thermal environments
pH dependenceActivity measurements across physiological pH rangeIdentifies optimal conditions and pH sensitivity differences
Copper/heme loadingMatched metal content between preparationsEnsures differences aren't due to variable cofactor loading
Protein concentrationActivity measurements at multiple protein concentrationsConfirms linearity of assay and accurate protein quantification
Complex formationAssays with reconstituted respiratory complexesDetermines whether activity differences persist in complex
Inhibitor sensitivityDose-response curves with known inhibitorsReveals potential structural differences at inhibitor binding sites

Additionally, time-dependent measurements are essential to distinguish initial rates from steady-state kinetics and to detect potential inactivation differences between recombinant and native forms.

How can researchers distinguish experimental artifacts from genuine species-specific features in MT-CO2 studies?

Distinguishing artifacts from genuine species-specific features requires systematic validation across multiple experimental approaches:

  • Cross-validation strategies:

    • Employ multiple expression systems to confirm consistent features

    • Use different purification approaches to eliminate method-specific artifacts

    • Compare properties across multiple independent preparations

  • Comparative analysis:

    • Include MT-CO2 from closely related species as reference points

    • Create chimeric constructs to map species-specific features to specific protein regions

    • Perform site-directed mutagenesis to systematically test the contribution of unique residues

  • Correlation with natural environments:

    • Test functional parameters under conditions mimicking Gerbillus gerbillus habitat

    • Compare activity patterns with ecological or physiological adaptations

    • Examine whether unique features provide selective advantages in desert conditions

  • Structural substantiation:

    • Verify that species-specific features are consistent with protein structure

    • Examine whether unique residues form coherent networks or clusters

    • Use molecular dynamics simulations to test the functional impact of species-specific residues

  • Evolutionary context:

    • Determine whether unique features are conserved in related desert-dwelling species

    • Calculate selection pressures on specific residues using dN/dS analysis

    • Examine whether features correlate with the GC content patterns observed in gerbil genomes

Features that persist across multiple expression systems, show correlation with ecological factors, and demonstrate evolutionary conservation are more likely to represent genuine species-specific adaptations rather than experimental artifacts.

How can recombinant MT-CO2 be used to study mitochondrial diseases associated with cytochrome c oxidase deficiency?

Recombinant MT-CO2 from Gerbillus gerbillus provides a valuable tool for studying mitochondrial diseases through several research applications:

  • Structure-function studies:

    • Introduce disease-associated mutations into recombinant MT-CO2

    • Assess functional consequences through activity assays and spectroscopic analysis

    • Map mutations onto Gerbillus gerbillus MT-CO2 structure to identify potential species-specific compensatory mechanisms

  • Complementation studies:

    • Develop cell lines with endogenous MT-CO2 deficiencies

    • Test whether recombinant Gerbillus gerbillus MT-CO2 can rescue function

    • Compare rescue efficiency between wild-type and mutant versions

  • Drug discovery applications:

    • Screen for small molecules that stabilize mutant MT-CO2

    • Identify compounds that enhance residual activity of disease-associated variants

    • Develop assays for high-throughput screening using recombinant protein

  • Comparative biochemistry:

    • Compare biochemical properties of MT-CO2 from Gerbillus gerbillus with human counterparts

    • Identify species-specific features that might confer resistance to dysfunction

    • Study mechanisms of assembly and stability that differ between species

  • Biomimetic approaches:

    • Identify structural elements from Gerbillus gerbillus MT-CO2 that could enhance human MT-CO2 stability

    • Design hybrid proteins incorporating beneficial features from gerbil MT-CO2

    • Test whether these hybrid constructs show improved resistance to pathogenic mutations

MT-CO2 has been identified as a biomarker for conditions like Huntington's disease and stomach cancer , making comparative studies particularly valuable for understanding disease mechanisms and developing diagnostic approaches.

What insights might comparative studies of MT-CO2 from various gerbil species provide about adaptation to different environments?

Comparative studies of MT-CO2 across gerbil species inhabiting different environments could reveal important adaptations in mitochondrial function:

  • Thermal adaptation mechanisms:

    • Compare MT-CO2 thermal stability profiles across species from different temperature regimes

    • Identify structural features that correlate with habitat temperature

    • Determine whether GC content patterns found in gerbil genomes correlate with thermal adaptation

  • Metabolic efficiency adaptations:

    • Compare enzyme kinetics parameters (Km, kcat) across species with different metabolic demands

    • Correlate catalytic efficiency with ecological factors like food availability

    • Investigate oxygen affinity differences in species from varying altitudes

  • Oxidative stress resistance:

    • Examine susceptibility to oxidative damage across desert vs. non-desert species

    • Identify structural features that may confer protection against reactive oxygen species

    • Test whether recombination patterns observed in gerbil genomes influence the evolution of oxidative stress resistance

  • Molecular evolution patterns:

    • Analyze whether MT-CO2 genes show evidence of GC-biased gene conversion observed in other gerbil genes

    • Determine whether GC content correlates with proximity to recombination hotspots

    • Investigate whether chromosomal location influences MT-CO2 evolution rates

  • Co-evolution with nuclear-encoded partners:

    • Examine whether MT-CO2 evolution correlates with changes in nuclear-encoded cytochrome c oxidase subunits

    • Identify compensatory mutations between mitochondrial and nuclear genomes

    • Investigate whether the unique chromosomal features observed in gerbils influence co-evolution between mitochondrial and nuclear genes

Such comparative studies could provide insights into how mitochondrial proteins adapt to environmental challenges and reveal potential applications for enhancing mitochondrial function in disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.