Recombinant Getah virus Structural polyprotein

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

The GETV Structural Polyprotein is a precursor protein encoded by the 3′-end open reading frame (ORF2) of the GETV genome. It undergoes post-translational cleavage to produce five structural proteins:

  • Capsid (C): Binds viral RNA and forms the nucleocapsid core .

  • E3, E2, 6K, and E1: Glycoproteins involved in viral entry, membrane fusion, and budding .

Recombinant versions are synthesized in heterologous systems (e.g., E. coli) for functional studies, antigen production, and vaccine development .

Antiviral Development

  • Recombinant structural polyproteins are used to generate neutralizing antibodies and evaluate antiviral compounds. For example, ivermectin was identified as a GETV inhibitor using a GFP-tagged recombinant virus .

  • Key Study: A lysine-to-arginine substitution at E2 residue 253 (K253R) enhances heparan sulfate binding, attenuating virulence in mice .

Pathogenesis Studies

  • The 6K protein, a cleavage product of the polyprotein, influences viral particle release. Deletion (rGETV-Δ6K) reduces viral titers and pathogenicity in piglets .

Key Research Findings

  • Conformational Flexibility: Cryo-EM structures reveal dynamic E1-E2 trimers at quasi-3-fold axes, essential for membrane curvature during budding .

  • Immune Evasion: The capsid protein inhibits interleukin-1 receptor-associated kinase (IRAK1) signaling, delaying host immune detection .

  • Glycosylation: N-linked glycans at E1 N141 and E2 N200/N262 modulate receptor binding and immune evasion .

Future Directions

  • Vaccine Design: Structural insights into E2’s heparan sulfate-binding site (e.g., residue 253) could inform live-attenuated vaccine development .

  • Antivirals: High-resolution maps of the E1-E2-capsid interface may enable targeted drug design .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Structural polyprotein; p130
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
816-1253
Protein Length
Full Length of Mature Protein
Species
Getah virus (GETV)
Target Protein Sequence
YEHTATIPNVVGFPYKAHIERNGFSPMTLQLEVLGTSLEPTLNLEYITCEYKTVVPSPYI KCCGTSECRSMERPDYQCQVYTGVYPFMWGGAYCFCDTENTQLSEAYVDRSDVCKHDHAA AYKAHTAAMKATIRISYGNLNQTTTAFVNGEHTVTVGGSRFTFGPISTAWTPFDNKIVVY KNDVYNQDFPPYGSGQPGRFGDIQSRTVESKDLYANTALKLSRPSSGTVHVPYTQTPSGF KYWIKERGTSLNDKAPFGCVIKTNPVRAENCAVGNIPVSMDIPDTAFTRVIDAPAVTNLE CQVAVCTHSSDFGGIATLTFKTDKPGKCAVHSHSNVATIQEAAVDIKTDGKITLHFSTAS ASPAFKVSVCSAKTTCMAACEPPKDHIVPYGASHNNQVFPDMSGTAMTWVQRVAGGLGGL TLAAVAVLILVTCVTMRR
Uniprot No.

Target Background

Function
The Getah virus structural polyprotein forms an icosahedral capsid with T=4 symmetry, composed of 240 copies of the capsid protein. This capsid is enveloped by a lipid membrane containing 80 spikes formed by trimers of E1-E2 heterodimers. The capsid protein binds to the viral RNA genome adjacent to a ribosome binding site, enabling viral genome translation after genome release. It exhibits protease activity, resulting in its autocatalytic cleavage from the nascent structural protein. After self-cleavage, the capsid protein transiently interacts with ribosomes, then rapidly binds to viral RNA and assembles into icosahedral core particles. This nucleocapsid subsequently associates with the cytoplasmic domain of the spike glycoprotein E2 at the cell membrane, leading to budding and formation of mature virions. Upon infection, new virions attach to target cells and undergo clathrin-mediated endocytosis, where their membrane fuses with the host endosomal membrane. This releases the nucleocapsid into the cytoplasm, followed by uncoating, making the genomic RNA accessible. Uncoating may be triggered by the capsid protein's interaction with ribosomes. Ribosome binding might release the genomic RNA, as the same region binds both genomic RNA and ribosomes. The structural polyprotein also plays a role in evading innate immune detection and activation. Specifically, it inhibits interleukin-1 receptor-associated kinase 1 (IRAK1)-dependent signaling during viral entry. This evasion strategy allows the alphaviruses to avoid immune recognition and activation before viral gene expression. The E3/E2 precursor's translocation to the host endoplasmic reticulum is mediated by a signal sequence within the polyprotein. The furin-cleaved E3 remains associated with spike glycoprotein E1, providing pH protection during transport through the secretory pathway. Following virion release, the assembly protein E3 is gradually released into the extracellular space. The E2 glycoprotein contributes to viral attachment to the host cell by binding to the cell receptor. It is synthesized as a p62 precursor, which is processed by furin at the cell membrane just before virion budding, yielding the E2-E1 heterodimer. While the p62-E1 heterodimer is stable, E2-E1 is unstable and dissociates at low pH. The p62 processing occurs as the final step, likely to prevent premature E1 fusion activation before its export to the cell surface. The E2 C-terminus contains a transitory transmembrane region that is disrupted by palmitoylation, reorienting the C-terminal tail from the lumenal to the cytoplasmic side. This step is crucial as the E2 C-terminus interacts with capsid proteins during budding. This release of the E2 C-terminus into the cytoplasm occurs late in protein export, preventing premature particle assembly at the endoplasmic reticulum membrane. The 6K protein is a constitutive membrane protein involved in virus glycoprotein processing, cell permeabilization, and viral particle budding. It disrupts calcium homeostasis, likely at the endoplasmic reticulum level, leading to cytoplasmic calcium elevation. The 6K protein's lipophilic properties suggest it influences the selection of lipids that interact with the glycoprotein transmembrane domains. This, in turn, affects the bilayer deformability needed for the extreme curvature during budding. The 6K protein is present in low amounts in virions, approximately 3% compared to viral glycoproteins. The E1 glycoprotein is a class II viral fusion protein. Its fusion activity remains inactive while bound to E2 in the mature virion. After virus attachment to the target cell and endocytosis, acidification of the endosome triggers dissociation of the E1/E2 heterodimer and subsequent trimerization of E1 subunits. This E1 trimer becomes fusion-active, promoting release of the viral nucleocapsid into the cytoplasm after endosome and viral membrane fusion. Efficient fusion requires the presence of cholesterol and sphingolipid in the target membrane. Optimal fusion occurs with approximately one cholesterol molecule per two phospholipid molecules and is specific for sterols containing a 3-beta-hydroxyl group.
Database Links

KEGG: vg:5075853

Subcellular Location
[Capsid protein]: Virion. Host cytoplasm. Host cell membrane. Host nucleus.; [Spike glycoprotein E2]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.; [6K protein]: Host cell membrane; Multi-pass membrane protein. Virion membrane; Multi-pass membrane protein.; [Spike glycoprotein E1]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

What is the Getah virus structural polyprotein and how is it organized?

The Getah virus structural polyprotein (p130) is encoded by the second open reading frame (ORF) of the GETV genome. This polyprotein undergoes post-translational processing to generate multiple structural components of the mature virion. The complete amino acid sequence includes regions that form the capsid protein and envelope glycoproteins (E1 and E2) . The structural polyprotein is cleaved into at least six chains, with the capsid protein being one of the primary components . The E1 glycoprotein ectodomain is organized into three subdomains: domain I (residues 1-36, 130-164, and 274-281), domain II (residues 37-129 and 165-273, containing a hydrophobic fusion loop), and domain III . This organization is critical for the assembly of the viral particle and its interaction with host cells.

How does the Getah virus genome relate to structural protein expression?

The GETV genome is approximately 11 kb in length and contains two distinct open reading frames (ORFs) . The first ORF encodes the non-structural proteins (nsP1-nsP4) as polyproteins P123 and P1234, which are subsequently processed into individual components . The second ORF encodes the structural polyprotein that forms the viral capsid and envelope proteins. The translation and processing of these polyproteins are temporally regulated during the viral life cycle to ensure proper assembly of viral particles. Understanding this genomic organization is essential for designing recombinant expression systems that accurately produce the structural polyprotein components for research purposes.

What expression systems are most effective for producing recombinant GETV structural polyproteins?

The methodology typically involves:

  • Gene optimization based on the expression system's codon usage preferences

  • Insertion into an appropriate vector with strong promoters

  • Inclusion of purification tags (His-tag or others) determined during the production process

  • Expression in controlled conditions with optimization of temperature, induction timing, and media composition

For structural studies requiring high purity, multi-step purification protocols involving affinity chromatography, ion-exchange, and size-exclusion chromatography have proven effective, as demonstrated in the purification of GETV macro domain for crystallographic studies .

What challenges are specific to expressing glycosylated envelope proteins of GETV?

Expression of glycosylated GETV envelope proteins presents several technical challenges:

  • Proper glycosylation: GETV E1 and E2 glycoproteins contain multiple glycosylation sites that play crucial roles in viral immune evasion and host cell invasion . Mammalian or insect cell expression systems are required to achieve appropriate glycosylation patterns.

  • Protein folding complexities: The E1-E2 heterodimer formation depends on proper folding and disulfide bond formation, which can be difficult to achieve in recombinant systems.

  • Transmembrane domain issues: The envelope proteins contain hydrophobic transmembrane domains that can cause aggregation during expression and purification.

To address these challenges, researchers typically:

  • Use chaperon co-expression strategies

  • Employ mild detergents during purification

  • Consider expressing truncated versions (ectodomains) without transmembrane regions

  • Implement gradual refolding protocols

  • Add stabilizing agents like cholesterol during purification, as cholesterol molecules have been observed in hydrophobic pockets of E1-E2 heterodimers

What techniques have provided the most significant insights into GETV structural polyprotein architecture?

Cryo-electron microscopy (cryo-EM) has been pivotal in elucidating the structure of GETV particles. The highest resolution structure of GETV virion has been achieved at 2.8 Å using cryo-EM with block-based reconstruction methods to overcome the heterogeneity of the ~70nm virus . This technique revealed:

  • The icosahedral symmetry (T=4) organization comprising 60 quasi-three-fold symmetry trimers (Q-trimer) and 20 icosahedral three-fold symmetry trimers (I-trimer)

  • The detailed structure of the E1-E2-capsid heterotrimers

  • Specific interaction sites between structural proteins

  • The arrangement of 240 capsid proteins connecting with corresponding E2 proteins

For individual components, X-ray crystallography has been valuable, particularly for the macro domain structure determination at 2.0 Å resolution . Nuclear magnetic resonance (NMR) spectroscopy, hydrogen-deuterium exchange mass spectrometry, and small-angle X-ray scattering have complemented these approaches by providing additional dynamic information about protein flexibility and interaction interfaces.

How do glycosylation and S-acylation sites contribute to the structural integrity of GETV particles?

Glycosylation and S-acylation significantly impact GETV structural integrity through multiple mechanisms:

Glycosylation sites:

  • Surface-exposed glycans on E1 and E2 glycoproteins play critical roles in immune evasion through glycan shielding

  • These glycans facilitate viral entry by enhancing interactions with host cell receptors

  • Structural studies have revealed multiple glycosylation sites that contribute to protein stability

S-acylation sites:

  • S-acylation involves the covalent attachment of fatty acids to cysteine residues

  • In GETV structural proteins, S-acylation sites are involved in stabilizing the transmembrane assembly

  • These modifications enhance membrane association and improve structural stability of the viral envelope

The detailed mapping of these post-translational modifications through high-resolution structural techniques has provided insights into their roles in viral assembly, stability, and host cell interactions. These modifications represent potential targets for antiviral strategies and must be considered when expressing recombinant proteins for structural or functional studies.

What methodologies are most effective for studying the fusion activity of GETV envelope glycoproteins?

To investigate the fusion activity of GETV envelope glycoproteins, several complementary approaches can be employed:

  • Cell-cell fusion assays:

    • Express E1 and E2 glycoproteins in mammalian cells

    • Expose cells to low pH to trigger conformational changes

    • Quantify fusion events through fluorescent dye transfer or reporter gene expression

  • Liposome fusion assays:

    • Incorporate purified recombinant E1-E2 complexes into liposomes

    • Label liposomes with FRET pairs (fluorescence resonance energy transfer)

    • Monitor fusion kinetics upon pH change by measuring fluorescence changes

  • Site-directed mutagenesis:

    • Target the hydrophobic fusion loop in domain II of the E1 protein (residues 86-96)

    • Evaluate the impact of mutations on fusion activity

    • Correlate structural changes with functional outcomes

  • Structural transition analysis:

    • Use circular dichroism spectroscopy to monitor pH-dependent conformational changes

    • Employ hydrogen-deuterium exchange mass spectrometry to identify regions undergoing structural rearrangements

These approaches can reveal the molecular mechanisms underlying the fusion process, including the role of cholesterol molecules and phospholipids observed in the hydrophobic pocket that are essential for E1-E2 heterodimer stability .

How can researchers investigate interactions between GETV structural proteins and host factors?

Several methodologies are suitable for investigating GETV structural protein interactions with host factors:

  • Co-immunoprecipitation and pull-down assays:

    • Express tagged recombinant GETV structural proteins

    • Incubate with host cell lysates

    • Identify interacting partners through mass spectrometry

  • Proximity labeling techniques:

    • Fuse BioID or APEX2 enzymes to GETV structural proteins

    • Express in host cells to biotinylate proximal proteins

    • Identify labeled proteins through streptavidin purification and mass spectrometry

  • Surface plasmon resonance (SPR):

    • Immobilize purified GETV structural proteins on sensor chips

    • Flow potential host factors across the surface

    • Measure binding kinetics and affinity constants

  • Cryo-EM studies of complexes:

    • Similar to how Mxra8 receptor binding was characterized for Chikungunya virus, researchers can identify binding sites of host factors in the cleft created by adjacent GETV E1-E2 heterodimers

These techniques help elucidate the molecular basis of host-pathogen interactions and identify potential targets for therapeutic intervention.

How do structural features of GETV polyprotein correlate with its pathogenicity in different hosts?

GETV can cause pyrexia and reproductive losses in animals, with antibodies found in approximately 10% of healthy humans without reported clinical symptoms . The correlation between structural features and pathogenicity can be investigated through:

  • Structure-function analysis:

    • The high-resolution structure of GETV (2.8 Å) reveals surface-exposed glycans on E1 and E2 glycoproteins that impact immune evasion and host cell invasion

    • Variations in these glycosylation patterns likely contribute to host-specific pathogenicity

  • Animal models:

    • The GETV V1 strain isolated from pregnant sows that had abortions showed strong cytopathic effects

    • Mouse models have demonstrated GETV infectiousness and pathogenicity

    • Mobility impairments in pelvic limbs observed in animal models suggest viral infection in the nervous system

  • Receptor usage analysis:

    • Similar to how Mxra8 was identified as a receptor for Chikungunya virus, determining the receptors for GETV in different host tissues can explain tropism and pathogenesis

    • The structural features of the E1-E2 heterodimers that form receptor binding sites can be correlated with tissue specificity

Understanding these structure-pathogenicity relationships is essential for developing preventive and therapeutic strategies against GETV infections.

What immunogenic determinants of GETV structural polyprotein are most promising for vaccine development?

Based on structural and functional analyses, several immunogenic determinants of GETV structural polyprotein show promise for vaccine development:

  • E2 glycoprotein domains:

    • The E2 glycoprotein is organized into domains A, B, C, and D, with domains A and B forming surface-exposed regions that are primary targets for neutralizing antibodies

    • These domains contain epitopes that elicit protective immunity

  • Conserved regions across alphaviruses:

    • Targeting conserved epitopes could potentially provide cross-protection against multiple alphaviruses

    • The fusion loop of E1 glycoprotein and portions of domain III represent such conserved regions

  • Rational design approaches:

    • The high-resolution structure of GETV (2.8 Å) provides a foundation for structure-based antiviral and vaccine design

    • Stabilized prefusion conformations of E1-E2 heterodimers can present neutralizing epitopes more effectively

  • Recombinant subunit vaccines:

    • Expression of properly folded ectodomains of E1 and E2 glycoproteins can induce robust neutralizing antibody responses

    • These can be designed based on the detailed structural information available

When developing vaccines, it's important to consider the glycosylation patterns observed in native virions, as these post-translational modifications influence both immunogenicity and antigenicity.

How can the structural insights of GETV polyprotein be leveraged for antiviral drug design?

The high-resolution structural information of GETV polyprotein offers several promising avenues for rational antiviral drug design:

  • Targeting hydrophobic pockets:

    • The structure reveals cholesterol molecules and a phospholipid molecule in a transmembrane hydrophobic pocket that stabilizes the E1-E2 heterodimer

    • Small molecules designed to disrupt these interactions could destabilize the viral structure

  • Fusion inhibitors:

    • The detailed structure of the fusion loop (residues 86-96) in domain II of E1 provides a target for designing inhibitors that prevent conformational changes required for membrane fusion

    • These inhibitors would block viral entry into host cells

  • Protein-protein interaction inhibitors:

    • The structure reveals multiple protein-protein interactions including those between:

      • The E2 B domain and E1 domain II

      • E1-E1 interfaces within and between asymmetric units

      • E2-E2 interfaces that involve salt bridges and van der Waals contacts

    • Compounds that disrupt these interactions could prevent viral assembly or stability

  • Structure-based virtual screening:

    • Using the high-resolution structures for in silico screening of compound libraries

    • Molecular docking against identified binding pockets

    • Molecular dynamics simulations to evaluate binding stability

These structure-guided approaches can accelerate the discovery of antivirals with specific activity against GETV and potentially other related alphaviruses.

What methodological approaches best elucidate the role of macro domain in GETV replication?

The macro domain of GETV nsP3 plays crucial roles in ADP-ribose binding and de-ADP-ribosylation of host proteins, which are essential for viral replication . Advanced methodological approaches to study this domain include:

  • Structural comparison and analysis:

    • The GETV macro domain structure at 2.0 Å resolution reveals a unique substitution (serine replacing glycine at position 30) compared to other alphaviruses

    • Comparing this structure with other alphavirus macro domains provides insights into functional conservation and divergence

  • Enzyme kinetics and mechanistic studies:

    • The multiple conformations of ADP-ribose observed in the crystal structure, including a covalent bond between C′′1 of ADPr and a conserved Togaviridae-specific cysteine, provide snapshots of the de-ADP-ribosylation mechanism

    • Detailed kinetic analysis with purified recombinant macro domain can elucidate the catalytic mechanism

  • Cellular studies with mutant viruses:

    • Site-directed mutagenesis of key residues in the macro domain, particularly the serine at position 30 and the Togaviridae-specific cysteine

    • Generation of recombinant viruses carrying these mutations

    • Analysis of replication efficiency, virus-host interactions, and immune evasion

  • Proteomics approaches:

    • Identification of host proteins that are ADP-ribosylated during infection

    • Analysis of how the viral macro domain modifies the ADP-ribosylation landscape

    • Correlation of these modifications with changes in cellular functions

These methodological approaches can provide comprehensive insights into how the GETV macro domain contributes to viral replication and pathogenesis, potentially revealing new targets for therapeutic intervention.

Table 2: Post-translational Modifications in GETV Structural Proteins

Modification TypeProteinModification SitesFunctional RoleReference
N-linked GlycosylationE1/E2Multiple surface-exposed sitesImmune evasion, host cell invasion
S-acylationE1/E2Transmembrane regionsStabilization of transmembrane assembly
Lipid InteractionE1/E2Hydrophobic pocketCholesterol and phospholipid binding for stability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.