Recombinant Gibberella intermedia Ent-kaurene oxidase (CYP503A1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please specify this during your order; we will prioritize fulfilling your request.
Synonyms
CYP503A1; Ent-kaurene oxidase; Cytochrome P450 503A1; Cytochrome P450-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Gibberella intermedia (Bulb rot disease fungus) (Fusarium proliferatum)
Target Names
CYP503A1
Target Protein Sequence
MNKSNSMNNTSLERLFQQLVLGLDGIPLMDVHWLIYVAFGAWLCSYVIHVLSSSSTVKVP VVGYRSVFEPTWLLRLRFVWEGGSIIGQGYNKFKDSIFQVRKLGTDIVIIPPNFIDEVRK LSQDKTRSVEPFINDFAGQYTRGMVFLQSDLQNRVIQQRLTPKLVSLTKVMKEELDYALT KEIPDMKDDEWVEVDISSIMVRLISRISARVFLGPEHCRNQEWLTNTAEYSESLFITGFI LRVVPHILRPFIAPLLPSYRTLLRNVSSGRRVIGDIIRSQQGDGNEDILSWMRDAATGEE KQIDNIAQRMLILSLASIHTTAMTMTHAMYDLCARPEYIEPLRDEVKGVVDASGWDKTAL NRLHRLDSFLKESQRFNPVFLLTFNRIYHQSMTLSDGTNLPSGTRIAVPSHAMLQDSAHV PGPTPPTEFDGFRYSKIRSDSNYAQKYLFSMTDSSNMAFGYGKYACPGRFYASNEMKLTL AILLLQFEFKLPDGKGRPRNITIDSDMIPDPRARLCVRKRSLRDE
Uniprot No.

Target Background

Function

This enzyme catalyzes three sequential oxidations of the 4-methyl group of ent-kaurene, producing kaurenoic acid. This is a critical step in gibberellin (GA) biosynthesis.

Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the biochemical function of Ent-kaurene oxidase in Gibberella species?

Ent-kaurene oxidase (KO) in Gibberella species catalyzes the three-step oxidation of ent-kaurene to ent-kaurenoic acid in the gibberellin biosynthetic pathway. This cytochrome P450 monooxygenase plays a crucial role in the early oxidative steps of gibberellin production. In the reaction sequence, KO performs repeated hydroxylation of the C-19 position of ent-kaurene, with the intermediate diol undergoing dehydration to form ent-kaurenal before further hydroxylation to ent-kaurenoic acid . Kinetic analyses have shown that the first hydroxylation to ent-kaurenol is typically the rate-limiting step in this process, and the intermediates remain at the enzyme active site during the sequential oxidations . In Gibberella fujikuroi, which is closely related to G. intermedia, the enzyme has been characterized as having typical cytochrome P-450 spectra and showing inhibition of enzymatic activity by carbon monoxide, confirming its classification as a P450 enzyme .

How does fungal Ent-kaurene oxidase differ from plant homologs?

Fungal ent-kaurene oxidases and plant KOs share the same basic function of converting ent-kaurene to ent-kaurenoic acid, but they differ in several important aspects:

  • Cellular localization: While plant KOs like those in Arabidopsis associate with the outer chloroplast membrane and possibly the endoplasmic reticulum , fungal KOs from Gibberella are microsomal enzymes that can be solubilized with buffers or salt solutions .

  • Evolutionary classification: Plant KOs belong to the CYP701A subfamily of cytochrome P450s , whereas fungal KOs from Gibberella are classified in the CYP503 family (CYP503A1) .

  • Inhibitor sensitivity: Both plant and fungal KOs are inhibited by triazole compounds like paclobutrazol, but potentially with different binding affinities. In Gibberella, enzyme activity assays have demonstrated characteristic binding of paclobutrazol to the P-450 form of the protein .

  • Stability factors: Research on Gibberella fujikuroi KO has shown that adding 20% glycerol to the extraction buffer stabilizes the enzyme activity, with loss of activity during storage accompanied by conversion of P-450 to P-420 form . This specific stability characteristic may differ in plant KOs.

Understanding these differences is crucial for designing experimental approaches when working with recombinant versions of these enzymes from different organisms.

What are the optimal conditions for heterologous expression of Recombinant Gibberella intermedia CYP503A1?

Successful heterologous expression of cytochrome P450 enzymes like Gibberella intermedia Ent-kaurene oxidase (CYP503A1) requires careful optimization of several parameters:

  • Expression system selection: While no specific data is available for G. intermedia CYP503A1, related research on KOs from Scoparia dulcis has demonstrated successful expression in Escherichia coli after modification of the N-terminal region to adapt the enzyme to the bacterial expression system . This suggests that similar N-terminal modifications may be necessary for optimal expression of G. intermedia CYP503A1 in E. coli.

  • Membrane protein considerations: As a microsomal P450 enzyme, CYP503A1 requires specific conditions for proper folding and integration into membranes. The microsomal enzyme activity from Gibberella fujikuroi was successfully solubilized with buffers or salt solutions at a concentration of 400 mM , which provides guidance for extraction approaches.

  • Stabilization strategies: For related KO enzymes, the addition of 20% glycerol to extraction buffers has been shown to stabilize activity . This should be considered when designing expression and purification protocols for recombinant CYP503A1.

  • Co-expression considerations: Successful functional expression may require co-expression with appropriate redox partners (cytochrome P450 reductase) to ensure electron transfer necessary for catalytic activity.

When monitoring expression success, both the soluble and microsomal preparations should show characteristic cytochrome P-450 spectra, and conversion of P-450 to P-420 should be minimized as this is associated with loss of enzymatic activity .

How can I develop a reliable activity assay for recombinant CYP503A1?

Developing a reliable activity assay for recombinant CYP503A1 requires careful consideration of substrate preparation, reaction conditions, and product detection methods:

Substrate preparation:

  • Use ent-[³H]kaurene as a substrate for high sensitivity detection, as demonstrated in assays for G. fujikuroi ent-kaurene oxidase .

  • Alternatively, unlabeled ent-kaurene can be used with appropriate analytical methods for product detection.

Reaction conditions:

  • Based on characterization of related KO enzymes, the assay should include:

    • An appropriate buffer system (pH 7.0-7.5)

    • NADPH regenerating system (NADPH, glucose-6-phosphate, glucose-6-phosphate dehydrogenase)

    • Appropriate cofactors (Mg²⁺, though note that high concentrations may be inhibitory for some related enzymes)

    • Potential stabilizing agents (20% glycerol has been shown to stabilize related enzymes)

Activity measurement approaches:

  • Direct product quantification: Use HPLC, GC-MS, or LC-MS to detect and quantify the formation of ent-kaurenoic acid and/or the intermediates ent-kaurenol and ent-kaurenal.

  • Spectrophotometric monitoring: Monitor NADPH consumption at 340 nm as an indirect measure of enzyme activity.

  • Inhibition studies: Include known inhibitors like paclobutrazol or carbon monoxide to validate the specificity of the observed activity .

Data analysis:

  • Calculate Michaelis-Menten kinetic parameters (Km, Vmax) for the membrane-bound and soluble enzyme preparations.

  • Determine binding constants for ent-kaurene and inhibitors like paclobutrazol to both the P-450 and P-420 forms of the protein .

What are the critical residues for substrate binding and catalysis in CYP503A1?

While specific information on critical residues in Gibberella intermedia CYP503A1 is not directly available from the search results, insights can be drawn from research on related cytochrome P450 enzymes involved in terpenoid metabolism:

  • Heme-binding domain: All functional cytochrome P450 enzymes, including CYP503A1, contain a conserved heme-binding domain typically featuring an invariant cysteine residue that serves as the fifth ligand to the heme iron. This cysteine is essential for catalytic activity.

  • Substrate recognition sites (SRS): CYP enzymes typically contain six SRS regions that form the substrate-binding pocket. Based on studies of related enzymes, the SRS regions likely play critical roles in determining the specificity for ent-kaurene as a substrate.

  • Oxygen activation: Conserved residues in the I-helix, particularly a threonine residue, are typically involved in proton delivery during oxygen activation in P450 enzymes.

  • Inhibitor binding: The research on G. fujikuroi KO demonstrated ligand binding of paclobutrazol to both the P-450 and P-420 forms of the protein , suggesting the presence of specific binding sites for this plant growth regulator that may overlap with the substrate binding site.

To definitively identify the critical residues in CYP503A1, techniques such as site-directed mutagenesis, homology modeling based on structurally characterized P450s, and substrate docking studies would be necessary. Research on the similar cytochrome P450 family has demonstrated that comparing binding constants for ent-kaurene and paclobutrazol to different forms of the protein can provide insights into structure-function relationships .

How does CYP503A1 achieve regioselectivity in ent-kaurene oxidation?

The regioselectivity of CYP503A1 in ent-kaurene oxidation is a sophisticated aspect of its catalytic mechanism. Although specific details for G. intermedia CYP503A1 are not directly provided in the search results, insights can be drawn from related KO enzymes:

  • Selective C-19 oxidation: CYP503A1, like other ent-kaurene oxidases, selectively targets the C-19 methyl group of ent-kaurene for sequential oxidation to create ent-kaurenoic acid . This specificity is likely achieved through precise positioning of the substrate in the active site, orienting the C-19 methyl group toward the activated oxygen species at the heme center.

  • Multi-step oxidation process: The oxidation sequence proceeds through distinct intermediates (ent-kaurenol and ent-kaurenal) before producing ent-kaurenoic acid. Research on related KO enzymes suggests that these intermediates remain at the enzyme active site during the sequential oxidations, with the first hydroxylation to ent-kaurenol being the rate-limiting step .

  • Comparison with related enzymes: It's noteworthy that some related KO-like enzymes, such as OsKO4 (CYP701A8) in rice, hydroxylate ent-kaurene at the 3α position rather than C-19 , highlighting how subtle differences in active site architecture can dramatically alter regioselectivity.

To fully understand the regioselectivity determinants of CYP503A1, experimental approaches might include:

  • Homology modeling based on structurally characterized P450s

  • Docking studies with ent-kaurene and reaction intermediates

  • Site-directed mutagenesis of residues predicted to be involved in substrate positioning

  • Comparative analysis with related enzymes that exhibit different regioselectivity patterns

What compounds effectively inhibit CYP503A1 activity and how do they compare to inhibitors of plant KO enzymes?

Several compounds have been identified as inhibitors of ent-kaurene oxidase activity, with both similarities and differences between fungal CYP503A1 and plant KO enzymes:

  • Triazole compounds:

    • Paclobutrazol has been demonstrated to bind to and inhibit the G. fujikuroi KO enzyme, showing characteristic ligand binding spectra with both the P-450 and P-420 forms of the protein .

    • Uniconazole is another effective KO inhibitor, shown to affect plant KO activity in Arabidopsis .

  • Carbon monoxide:

    • Inhibition of enzymatic activity by carbon monoxide is a characteristic feature of G. fujikuroi KO, confirming its classification as a cytochrome P450 enzyme .

    • This inhibition is a common feature of cytochrome P450 enzymes, as CO competes with oxygen for binding to the reduced heme iron.

  • Comparative sensitivity:

    • While both fungal and plant KOs are inhibited by triazole compounds, their relative sensitivities may differ.

    • In Arabidopsis, plants with increased KO expression (35S:KO or 35S:KO-GFP) showed partial resistance to paclobutrazol and uniconazole, while plants with decreased KO levels displayed increased sensitivity .

  • Practical applications:

    • The differential sensitivity to inhibitors has been leveraged in plant systems, where modification of KO enzyme levels could be used to create transgenic crop plants with altered KO inhibitor response, and the KO gene could potentially serve as a selectable marker for plant regeneration based on resistance to KO inhibitors .

Understanding these inhibition patterns is crucial for developing specific assays and potentially designing targeted inhibitors that could differentiate between fungal and plant KO enzymes.

How is CYP503A1 activity regulated at the molecular and cellular levels?

The regulation of CYP503A1 activity occurs at multiple levels, based on insights from research on related KO enzymes:

Transcriptional regulation:

  • In plants like Scoparia dulcis, KO genes are differentially expressed in various tissues, with SdKO1 and SdKO2 mainly expressed in root and lateral root systems, which are elongating tissues .

  • While specific transcriptional regulation of G. intermedia CYP503A1 is not directly addressed in the search results, it's likely that its expression is coordinated with other gibberellin biosynthetic enzymes to regulate hormone production.

Post-translational regulation:

Understanding these regulatory mechanisms is essential for optimizing recombinant enzyme production and developing strategies to modulate gibberellin biosynthesis in various contexts.

How do the kinetic properties of fungal CYP503A1 compare to plant KO enzymes?

The kinetic properties of fungal and plant KO enzymes reveal important functional differences:

Kinetic parameters for fungal KO:

  • Michaelis-Menten kinetic parameters for the membrane-bound and soluble enzyme from G. fujikuroi have been estimated, providing insights into substrate affinity and catalytic efficiency .

  • Binding constants for both ent-kaurene and paclobutrazol to the P-450 and P-420 forms of the protein have been determined, offering a quantitative measure of substrate and inhibitor interactions .

Comparative aspects:

  • Substrate affinity: While specific comparative values are not provided in the search results, the ability to bind and convert ent-kaurene to ent-kaurenoic acid is conserved between fungal and plant enzymes, despite their evolutionary distance.

  • Catalytic efficiency: In the oxidation of ent-kaurene, the first hydroxylation to ent-kaurenol has been identified as the rate-limiting step in some KO enzymes , but comparative catalytic efficiencies between fungal and plant enzymes would require direct experimental comparison.

  • Inhibitor sensitivity: Both fungal and plant KOs are inhibited by triazole compounds like paclobutrazol, but their relative sensitivities may differ. In Arabidopsis, modulation of KO expression levels altered the sensitivity to these inhibitors , suggesting that the ratio of enzyme to inhibitor is a key determinant of inhibitory effects.

  • Solubilization characteristics: The microsomal enzyme activity from G. fujikuroi was successfully solubilized with buffers or salt solutions at a concentration of 400 mM , which may differ from the solubilization requirements of plant KO enzymes.

A comprehensive comparative kinetic analysis would require side-by-side assays under identical conditions, which appears to be absent from the current literature based on the search results.

What are the evolutionary relationships between fungal and plant ent-kaurene oxidases?

The evolutionary relationships between fungal and plant ent-kaurene oxidases reveal a fascinating case of functional convergence despite structural divergence:

  • Taxonomic classification:

    • Fungal ent-kaurene oxidases from Gibberella belong to the CYP503 family (specifically CYP503A1) .

    • Plant KOs belong to the CYP701A subfamily , a completely different cytochrome P450 family.

  • Functional convergence:

    • Despite their divergent evolutionary origins, both fungal and plant KO enzymes catalyze the same reaction: the three-step oxidation of ent-kaurene to ent-kaurenoic acid in the gibberellin biosynthetic pathway.

    • This represents a case of convergent evolution where different protein scaffolds have evolved to perform the same catalytic function.

  • Gibberellin pathway evolution:

    • Gibberellins are produced by all vascular plants and several fungal and bacterial species that associate with plants as pathogens or symbionts .

    • The presence of this pathway across diverse organisms suggests that gibberellin production has evolved independently multiple times, with fungi like Gibberella potentially developing this pathway to manipulate plant growth during pathogenic interactions.

  • Structural considerations:

    • Despite catalyzing the same reaction, the different classification of fungal and plant KOs suggests significant differences in their primary sequences and potentially in their three-dimensional structures.

    • Both enzyme types maintain the characteristic features of cytochrome P450 enzymes, including a conserved heme-binding domain and substrate recognition sites, but these are likely arranged differently in the two enzyme families.

This evolutionary divergence has important implications for inhibitor design and specificity, as compounds that target structural features unique to fungal CYP503A1 might not affect plant CYP701A enzymes, potentially allowing for selective inhibition of gibberellin biosynthesis in fungal pathogens without affecting the host plant.

How can recombinant CYP503A1 be utilized in biosynthetic pathway engineering?

Recombinant CYP503A1 offers several valuable applications in biosynthetic pathway engineering:

  • Heterologous gibberellin production:

    • Incorporating CYP503A1 into heterologous expression systems could enable the production of gibberellins in non-native hosts for agricultural or pharmaceutical applications.

    • As a key enzyme in the early oxidative steps of the pathway, CYP503A1 could be combined with other gibberellin biosynthetic enzymes in microbial hosts to create a complete production pathway.

  • Generation of novel diterpenoids:

    • The substrate specificity of CYP503A1 could potentially be exploited to oxidize non-native diterpene substrates, generating novel compounds with potentially useful biological activities.

    • Engineering CYP503A1 through directed evolution or rational design might expand its substrate range to accept structurally related diterpenes.

  • Inhibitor screening platforms:

    • Recombinant CYP503A1 could serve as a platform for screening potential fungicidal compounds that specifically target fungal gibberellin biosynthesis without affecting plant counterparts.

    • The established inhibition by paclobutrazol provides a positive control for such screening efforts.

  • Comparative biochemical studies:

    • Direct comparison of fungal CYP503A1 with plant KO enzymes (CYP701A family) using recombinant proteins could provide insights into the evolution of convergent catalytic functions in divergent enzyme scaffolds.

    • Such studies could also identify specific features that confer selective inhibition, potentially leading to the development of targeted antifungal agents.

To optimize these applications, researchers would need to address challenges such as proper folding and membrane integration of the recombinant enzyme, as well as ensuring appropriate electron transfer through co-expression with suitable redox partners.

What role does CYP503A1 play in fungal pathogenicity on plants?

The role of CYP503A1 in fungal pathogenicity is linked to gibberellin production and its effects on plant physiology:

  • Gibberellin as a virulence factor:

    • As a key enzyme in gibberellin biosynthesis, CYP503A1 enables fungi like Gibberella to produce plant hormones that can disrupt normal plant development.

    • Gibberellins produced by pathogenic fungi can induce excessive elongation in host plants, potentially causing lodging (falling over) in cereal crops and other growth abnormalities that compromise plant health and yield.

  • Manipulation of host defense responses:

    • Fungal-produced gibberellins may interfere with the plant's hormonal balance, potentially suppressing defense responses that depend on other phytohormones such as jasmonic acid or salicylic acid.

    • This hormonal manipulation could represent a sophisticated virulence strategy to enhance fungal colonization and reproduction.

  • Comparative virulence strategies:

    • While some fungal species produce gibberellins as virulence factors, others have evolved to produce different diterpenoids involved in plant defense responses.

    • For example, in rice, KO-like genes have proliferated with functional diversification to produce diterpenoids involved in plant defense, illustrating the complex evolutionary interplay between plants and pathogens .

  • Potential targets for disease control:

    • Understanding the role of CYP503A1 in fungal pathogenicity opens avenues for targeted disease control strategies.

    • Inhibitors specific to fungal ent-kaurene oxidases could potentially suppress gibberellin production in pathogens without affecting the host plant's endogenous gibberellin biosynthesis, providing a selective approach to disease management.

Research into these aspects would benefit from experimental approaches such as gene knockout studies, heterologous expression of CYP503A1 in non-pathogenic fungi, and detailed analysis of gibberellin profiles during plant-pathogen interactions.

What are the best methods for studying CYP503A1 protein-protein interactions in gibberellin biosynthesis?

Investigating protein-protein interactions involving CYP503A1 requires specialized approaches suitable for membrane-associated cytochrome P450 enzymes:

  • Co-immunoprecipitation (Co-IP) with membrane solubilization:

    • Solubilize the microsomal fraction containing CYP503A1 using buffers or salt solutions at a concentration of 400 mM, as demonstrated effective for G. fujikuroi KO .

    • Use antibodies against CYP503A1 or epitope-tagged versions of the protein to pull down potential interaction partners.

    • Include 20% glycerol in buffers to maintain enzyme stability during the procedure .

  • Bimolecular Fluorescence Complementation (BiFC):

    • Create fusion constructs of CYP503A1 and potential interaction partners with complementary fragments of a fluorescent protein.

    • Express these constructs in a suitable heterologous system (fungal, yeast, or plant cells).

    • Reconstitution of fluorescence indicates proximity of the proteins, suggesting interaction.

  • Förster Resonance Energy Transfer (FRET):

    • Generate fusion proteins of CYP503A1 and potential partners with appropriate fluorophores.

    • FRET occurs when the donor and acceptor fluorophores are in close proximity (typically <10 nm), indicating protein-protein interaction.

    • This approach is particularly valuable for studying dynamic interactions in living cells.

  • Yeast two-hybrid membrane system adaptations:

    • Use specialized membrane yeast two-hybrid systems designed for studying interactions involving membrane proteins.

    • Create fusion constructs with the membrane-spanning domains of CYP503A1 properly oriented.

  • Mass spectrometry-based approaches:

    • Perform cross-linking followed by immunoprecipitation and mass spectrometry (XL-MS) to identify proteins in close proximity to CYP503A1.

    • Use quantitative proteomics approaches such as SILAC (Stable Isotope Labeling with Amino acids in Cell culture) to identify proteins that co-purify with CYP503A1 under different conditions.

Key potential interaction partners to investigate would include cytochrome P450 reductase (essential for electron transfer), other enzymes in the gibberellin biosynthetic pathway such as ent-kaurenoic acid oxidase (KAO), and potentially regulatory proteins that might modulate CYP503A1 activity.

How can cryo-EM or crystallography approaches be optimized for structural studies of CYP503A1?

Structural characterization of CYP503A1 through cryo-EM or crystallography presents significant challenges but can be approached with specialized strategies:

Crystallography approaches:

  • Protein engineering for crystallization:

    • Remove the hydrophobic N-terminal membrane anchor or replace it with solubilizing fusion partners like maltose-binding protein (MBP) or thioredoxin.

    • Create truncated constructs focusing on the catalytic domain.

    • Introduce surface mutations to reduce surface entropy and promote crystal contacts.

  • Lipidic cubic phase (LCP) crystallization:

    • Use LCP methods specifically designed for membrane proteins, which maintain the protein in a lipid environment.

    • Screen different lipid compositions to identify optimal conditions for CYP503A1 stability and crystal formation.

  • Co-crystallization strategies:

    • Include ligands (substrate ent-kaurene, product ent-kaurenoic acid, or inhibitors like paclobutrazol) to stabilize the protein in a defined conformation.

    • Consider co-crystallization with antibody fragments (Fab or nanobody) to provide additional crystal contacts.

Cryo-EM approaches:

  • Sample preparation optimization:

    • Incorporate CYP503A1 into nanodiscs with defined lipid compositions to provide a native-like membrane environment while enabling single-particle analysis.

    • Use detergent screening to identify conditions that maintain protein stability and homogeneity.

    • Consider GraFix (gradient fixation) to improve particle stability.

  • Increasing molecular size for better particle visualization:

    • Generate fusion constructs with larger proteins to increase the molecular weight above the typical detection limit for cryo-EM (~100 kDa).

    • Consider complexes with antibody fragments or natural binding partners.

  • Data collection and processing strategies:

    • Employ state-of-the-art detectors and phase plates to enhance contrast.

    • Implement sophisticated image processing algorithms to deal with conformational heterogeneity.

    • Use 3D classification to separate different conformational states.

Common considerations for both methods:

  • Protein production: Optimize heterologous expression systems to produce sufficient quantities of properly folded protein, potentially including chaperones and heme synthesis components.

  • Stability assessment: Use thermal shift assays and size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to identify buffer conditions that enhance protein stability and homogeneity.

  • Functional validation: Ensure that engineered constructs retain catalytic activity or ligand binding capability to confirm biological relevance of any structural data obtained.

What are common challenges in recombinant expression of CYP503A1 and how can they be addressed?

Recombinant expression of cytochrome P450 enzymes like CYP503A1 presents several challenges that require specific strategies:

Challenge 1: Poor expression levels

  • Solution approaches:

    • Optimize codon usage for the expression host

    • Test different promoter strengths and induction conditions

    • Use specialized expression strains with enhanced capabilities for membrane protein expression

    • Consider adding chaperones to assist in proper folding

    • Explore different fusion partners (such as thioredoxin, MBP, or SUMO) to enhance solubility

Challenge 2: Improper folding and incorporation of heme

  • Solution approaches:

    • Supplement growth media with δ-aminolevulinic acid (ALA), a heme precursor

    • Co-express heme biosynthesis enzymes

    • Lower the expression temperature (e.g., 16-20°C) to slow protein production and allow proper folding

    • Consider expression in eukaryotic hosts like yeast or insect cells that may better handle P450 folding

Challenge 3: Conversion of active P-450 to inactive P-420 form

  • Solution approaches:

    • Add 20% glycerol to extraction and storage buffers, as this has been shown to stabilize activity in G. fujikuroi KO

    • Include appropriate detergents or lipids to maintain proper membrane environment

    • Avoid freeze-thaw cycles

    • Monitor the P-450 to P-420 ratio spectrophotometrically as a quality control measure

Challenge 4: Low or absent enzymatic activity

  • Solution approaches:

    • Co-express appropriate redox partners (cytochrome P450 reductase)

    • Ensure proper NADPH regeneration in activity assays

    • Optimize buffer composition, pH, and ionic strength

    • Use multiple detection methods to confirm activity (direct product detection via HPLC/MS and spectrophotometric NADPH consumption assays)

Challenge 5: N-terminal modification requirements

  • Solution approaches:

    • Consider N-terminal modifications similar to those used successfully for KOs from Scoparia dulcis in E. coli expression systems

    • Test different N-terminal truncations to remove the hydrophobic membrane anchor while preserving catalytic function

    • Try chimeric constructs with N-terminal regions from successfully expressed P450s

Implementing these strategies should help overcome the common challenges associated with recombinant expression of CYP503A1 and lead to the production of functional enzyme for further studies.

What analytical techniques are most effective for assessing the purity and functionality of recombinant CYP503A1?

A comprehensive quality control strategy for recombinant CYP503A1 should include multiple analytical techniques addressing purity, structural integrity, and functional activity:

Purity assessment:

  • SDS-PAGE analysis:

    • Visualize protein purity and approximate molecular weight

    • Consider both Coomassie staining and more sensitive silver staining

    • Western blotting with antibodies against CYP503A1 or epitope tags can confirm identity

  • Size exclusion chromatography (SEC):

    • Assess protein homogeneity and oligomeric state

    • Detect potential aggregation or degradation products

    • Can be coupled to multi-angle light scattering (MALS) for precise molecular weight determination

  • Mass spectrometry:

    • Intact protein mass analysis to confirm correct processing and modifications

    • Peptide mapping after proteolytic digestion to verify sequence coverage and identify post-translational modifications

Structural integrity assessment:

  • UV-visible spectroscopy:

    • Monitor the characteristic Soret band of cytochrome P450 at approximately 450 nm when reduced and bound to carbon monoxide

    • Track the ratio of P-450 to P-420 forms, as conversion to P-420 is associated with loss of enzymatic activity

    • Measure ligand binding spectra with substrate (ent-kaurene) and inhibitors (paclobutrazol)

  • Circular dichroism (CD) spectroscopy:

    • Evaluate secondary structure content and proper protein folding

    • Monitor thermal stability through temperature-dependent CD measurements

  • Fluorescence spectroscopy:

    • Intrinsic tryptophan fluorescence can indicate proper folding

    • Binding of fluorescent ligands can provide information on active site integrity

Functional activity assessment:

  • Enzyme activity assays:

    • Direct measurement of ent-kaurene conversion to ent-kaurenoic acid and intermediates using HPLC, GC-MS, or LC-MS

    • Spectrophotometric assays monitoring NADPH consumption at 340 nm

    • Inhibition studies with carbon monoxide and paclobutrazol as positive controls

  • Binding assays:

    • Determine binding constants for ent-kaurene and paclobutrazol to both the P-450 and P-420 forms of the protein

    • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) for quantitative binding parameters

  • Michaelis-Menten kinetics:

    • Determine key kinetic parameters (Km, Vmax, kcat) for comparison with published values for related enzymes

    • Compare parameters between membrane-bound and solubilized enzyme preparations

By combining these analytical approaches, researchers can comprehensively assess the quality of recombinant CYP503A1 preparations and ensure that the protein is suitable for downstream applications such as structural studies, inhibitor screening, or biosynthetic pathway engineering.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.