Recombinant Gibberella zeae Cytochrome c oxidase assembly protein COX16, mitochondrial (COX16)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Gibberella zeae COX16

Recombinant Gibberella zeae cytochrome c oxidase assembly protein COX16 (mitochondrial) is a bioengineered version of the native COX16 protein, produced in heterologous systems for research or therapeutic applications. COX16 belongs to the cytochrome c oxidase (COX) assembly machinery, critical for the biogenesis of Complex IV in the mitochondrial respiratory chain. While COX16's role in humans and yeast has been extensively studied, its recombinant form from Gibberella zeae (a fungal pathogen) remains less characterized. Below is a synthesis of available data on its molecular features, production methods, and inferred functional insights.

Expression Systems

Host SystemTagsApplications
E. coliGST, His, DDK, MycStructural studies, antibody production
YeastAvi, FcNative-like folding, protein-protein interaction
Cell-Free ExpressionNon-taggedHigh-throughput screening, enzymatic assays

Core Functions

  1. Copper Metallation: In humans, COX16 facilitates copper insertion into the CuA site of COX2 via interactions with metallochaperones (e.g., SCO1, COA6) .

  2. Subunit Assembly: COX16 bridges COX1 and COX2 assembly pathways, enabling their integration into mature COX complexes .

  3. Stability and Chaperoning: Stabilizes nascent COX subunits during translation and assembly .

Research Applications

Recombinant COX16 serves as a tool for studying:

  • Structural Biology: Elucidating COX16's binding interfaces with SCO1 or COX2.

  • Disease Modeling: Investigating COX deficiency phenotypes linked to human COX16 mutations .

  • Antifungal Targets: Exploring COX16 as a potential therapeutic target in Gibberella zeae pathogenesis.

Challenges and Limitations

  1. Knowledge Gaps: No peer-reviewed studies directly analyze Gibberella zeae COX16's function.

  2. Expression Heterogeneity: Variable yields and folding efficiency across hosts (e.g., E. coli vs. mammalian cells) .

  3. Functional Redundancy: Partial redundancy with other COX assembly factors (e.g., COX18) may obscure its role in knockout models .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have a specific format requirement, kindly indicate it in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time estimates.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
COX16; FGRRES_06413; FGSG_06413; Cytochrome c oxidase assembly protein COX16, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
12-115
Protein Length
Full Length of Mature Protein
Species
Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)
Target Names
COX16
Target Protein Sequence
AADMNSIGMRYRNLMNKHPFLMFGLPFLTVIVAGSFVLTPATAVRYERYDRKVRQMTKDE ELNVRRSARKVDMKEEYYRLAGKDLDDWEQKRVKRLPGENDGLL
Uniprot No.

Target Background

Function
COX16 is essential for the assembly of mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. It may play a role in merging the COX1 and COX2 assembly pathways.
Database Links
Protein Families
COX16 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the biological function of COX16?

COX16 is a conserved protein essential for cytochrome c oxidase biogenesis in the mitochondrial oxidative phosphorylation system. Research demonstrates that COX16 plays a crucial role in the assembly of mitochondrial respiratory chain complexes by facilitating the merging of COX1 and COX2 assembly pathways. This protein specifically interacts with newly synthesized COX2 and its copper center-forming metallochaperones including SCO1, SCO2, and COA6, implicating COX16 in CuA-site formation . Experimental evidence suggests COX16 is required for proper cytochrome c oxidase assembly, as knockout studies show significant reduction in complex IV levels and activity.

Where is COX16 localized within cells?

COX16 is an inner mitochondrial membrane protein with its C-terminus facing the intermembrane space (IMS). Unlike its yeast counterpart, human COX16 lacks a predictable N-terminal presequence. This localization has been confirmed through multiple experimental approaches including hypo-osmotic swelling and carbonate extraction experiments . The membrane integration of COX16 is consistent with its function in facilitating protein interactions during respiratory complex assembly within the mitochondrial inner membrane environment.

What experimental models are suitable for studying COX16 function?

Human cell lines such as HEK-293T cells have been successfully used for COX16 functional studies through CRISPR/Cas9-mediated gene disruption. Notably, research indicates that human COX16 does not complement the yeast mutant strain, suggesting significant functional divergence between species . When designing experiments, researchers should consider this species-specificity and utilize appropriate model systems that reflect the evolutionary context of their research question. Complementary approaches involving isolated mitochondria can provide insights into the biochemical properties of COX16.

What phenotypes result from COX16 deficiency?

CRISPR/Cas9-generated COX16 knockout cells display several characteristic phenotypes. These include approximately 50% reduction in cytochrome c oxidase levels and approximately 65% reduction in complex IV activity compared to wild-type controls . BN-PAGE analysis reveals that in the absence of COX16, COX1 predominantly accumulates in faster-migrating MITRAC assembly intermediate complexes rather than mature cytochrome c oxidase complexes. Additionally, pulse-chase experiments demonstrate significantly enhanced turnover of newly synthesized COX2 in COX16-deficient cells, indicating defects in stabilization and assembly of this subunit.

How can researchers assess COX16-dependent protein interactions?

To investigate COX16-dependent protein interactions, researchers should employ a combination of biochemical and molecular approaches. Immunoprecipitation of endogenous or tagged COX16 followed by western blotting can identify stable interaction partners. For transient interactions, crosslinking prior to isolation may be necessary. Pulse-chase labeling of mitochondrial translation products with [35S]methionine, followed by immunoisolation of COX16, can specifically detect interactions with newly synthesized mitochondrial proteins like COX2 . Researchers should consider using mild detergents such as digitonin for solubilization to preserve physiologically relevant protein complexes.

What techniques can assess functional consequences of COX16 manipulation?

Multiple complementary approaches should be employed to comprehensively evaluate COX16 function. BN-PAGE separation of respiratory complexes followed by in-gel activity staining for complexes I, IV, and V provides insights into assembly defects and enzymatic function . Quantitative assessment of cytochrome c oxidase activity using spectrophotometric methods and enzyme quantification by ELISA offers precise measurements of functional consequences. Two-dimensional BN/SDS-PAGE followed by western blotting can visualize changes in complex assembly patterns and subunit incorporation. Additionally, pulse-chase experiments help determine the stability and assembly kinetics of newly synthesized mitochondrial proteins.

How can researchers distinguish between direct and indirect effects of COX16 manipulation?

Distinguishing direct from indirect effects requires careful experimental design. Acute depletion systems (such as inducible knockdowns) can help separate primary from secondary consequences. Rescue experiments involving reintroduction of wild-type COX16 should reverse direct effects. Structure-function studies using point mutations in specific COX16 domains can pinpoint regions directly involved in particular interactions . Comparative analysis between early and late consequences of COX16 depletion, coupled with temporal assessment of different mitochondrial complexes and functions, can establish causality in observed phenotypes.

How does COX16 contribute to COX2 copper center formation?

COX16 plays a specific role in copper insertion into COX2 by facilitating the recruitment of copper chaperones. Research demonstrates that COX16 is required for SCO1 (but not SCO2) association with newly synthesized COX2 . This selective requirement suggests COX16 coordinates specific steps in the copper insertion pathway. Patient-mimicking mutations in SCO1 (G132S and P174L) significantly impair interaction with COX16 while maintaining COX2 association, indicating that COX16-SCO1 interaction is critical for proper copper center formation. The resulting CuA site is essential for electron transfer during cellular respiration.

What is the relationship between COX16 and mitochondrial disease mechanisms?

COX16 function intersects with known mitochondrial disease pathways, particularly those involving copper metabolism and cytochrome c oxidase assembly. Pathogenic mutations in SCO1 (causing hypertrophic cardiomyopathy, neonatal hepatopathy, and ketoacidotic comas) and COA6 (causing fatal infantile cardioencephalomyopathy) both disrupt interactions with COX16 . Understanding how COX16 contributes to these disease mechanisms may provide insights into pathogenesis and potential therapeutic strategies. Researchers should consider how COX16 dysfunction might manifest in patients with mitochondrial disorders characterized by cytochrome c oxidase deficiency.

How does the function of COX16 differ between species?

Significant differences exist between human and yeast COX16 function. While yeast Cox16p has been detected in mature cytochrome c oxidase and its supercomplexes, human COX16 appears to be exclusively associated with assembly intermediates and is absent from mature respiratory complexes . Additionally, human COX16 cannot functionally complement the yeast cox16 mutant, indicating divergent evolutionary paths. These differences highlight the importance of studying COX16 in species-appropriate contexts and suggest caution when extrapolating findings across evolutionary boundaries.

What controls are essential for COX16 functional studies?

Rigorous experimental design for COX16 studies should include multiple controls. For knockout/knockdown experiments, rescue with wild-type COX16 is crucial to confirm phenotype specificity. When examining protein interactions, both positive controls (known interaction partners like COX2) and negative controls (mitochondrial proteins from unrelated pathways) should be included . For assessing respiratory complex assembly and function, comparisons should include measurements of complexes unrelated to cytochrome c oxidase (such as Complex V) to distinguish specific from general mitochondrial defects. Time-course experiments can help establish the sequence of events following COX16 manipulation.

How can researchers study COX16-mediated assembly pathway integration?

To investigate how COX16 facilitates the merging of COX1 and COX2 assembly pathways, researchers should design experiments that selectively perturb specific assembly modules. This can be achieved by depleting early assembly factors specific to either COX1 (such as C12ORF62) or COX2 (such as FAM36A) . Immunoisolation of assembly intermediates followed by analysis of their composition can reveal the sequence of subunit incorporation. Time-resolved pulse-chase experiments combined with native gel electrophoresis can track the formation and progression of assembly intermediates. These approaches help establish the molecular mechanisms underlying COX16's role in coordinating assembly modules.

What approaches can identify novel regulatory mechanisms affecting COX16 function?

Identification of regulatory mechanisms requires exploration beyond constitutive interactions. Post-translational modification analysis using mass spectrometry can reveal regulatory modifications of COX16. Assessing COX16 function under various cellular stresses (oxidative stress, hypoxia, inhibition of mitochondrial translation) may uncover condition-specific regulation . Proximity labeling approaches (BioID or APEX) can identify transient interactors in the COX16 microenvironment. Gene expression analyses across tissues and developmental stages might reveal context-specific COX16 regulation patterns that contribute to tissue-specific mitochondrial adaptations.

What quantitative methods best assess COX16-dependent phenotypes?

Robust quantitative assessment requires multiple complementary approaches. Spectrophotometric enzyme activity assays provide functional measurements of cytochrome c oxidase. Quantitative ELISA for complex IV components offers precise protein level measurements . Image analysis of BN-PAGE or 2D gels should include multiple biological replicates with appropriate normalization to control proteins. For protein turnover studies, pulse-chase experiments with careful quantification at multiple timepoints provide kinetic insights. Statistical analysis should account for biological variability and include appropriate tests for significance based on data distribution.

Assay TypeMeasurementApplication in COX16 Research
In-gel activity stainingComplex IV activityDetect assembly defects in native complexes
ELISAComplex IV quantityPrecise quantification of mature enzyme levels
Spectrophotometric assayCytochrome c oxidase activityFunctional assessment of enzyme catalysis
Pulse-chase analysisProtein stabilityMeasure turnover rates of newly synthesized subunits
2D-BN/SDS-PAGEComplex assembly patternVisualize assembly intermediates and mature complexes

How can researchers distinguish between assembly and stability defects in COX16 studies?

Differentiating assembly from stability defects requires careful experimental design. Pulse-chase experiments can track the fate of newly synthesized mitochondrial-encoded subunits over time to determine if proteins are synthesized normally but degraded prematurely (stability defect) or fail to incorporate into higher complexes (assembly defect) . Analysis of assembly intermediates by native gel electrophoresis can reveal accumulation of specific assembly modules, indicating assembly pathway blocks. Proteasome or protease inhibition experiments can determine if enhanced degradation contributes to observed phenotypes. The spectrum of affected subunits can also provide clues—selective effects on specific subunits often indicate assembly defects, while broader effects may suggest general import or stability issues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.