Recombinant Gibberella zeae GPI mannosyltransferase 4 (SMP3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
SMP3; FGRRES_16739; FGSG_06923; GPI mannosyltransferase 4; GPI mannosyltransferase IV; GPI-MT-IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-492
Protein Length
full length protein
Species
Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)
Target Names
SMP3
Target Protein Sequence
MWRRTYLTLVLIRLWFALSPSYLHPDENFQGPEVIAGQIFSYPVRHTWEFTSENPIRSVF PLWPVYGLPMLLLRWLWIGNGQDGEIPPIAVFWTLRVLMFAISFVLEDWALHELIPSPKH RRVAVLLVASSYVTWTYQTHTFSNSVETLVVAWSLVLIQRVADPRCLVYSTESHFQRFLS SQAFDCFQYSGKAAAVTTVIAIGLDTAFYLPDSVTWTDLIHRPVITPLNNFKYNSATENL AQHGLHPWYQHLVGNLPLLLGPAAALLVIRPKLSIRLWSAMSGLVVLSAFQHQEARFLLP TVPLFLSSIRMPRNQTVFYIFTAVWIGFNLALGSLMGIYHQGGVVPGQVFLSQQPDATQA IWWKTYTPPIWLLNGKNEFLTTRDVMGLKGELLLEQLSQLATCDTPADRRNQEYLKEKNG TYLIAPASATWLDPYLSNKGLEGLRFREVWRYRKHLNLDDLDFGDDGVWDTLARVIGRRG LVAWRVTKSCPK
Uniprot No.

Target Background

Function
Alpha-1,2-mannosyltransferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers a fourth mannose to trimannosyl-GPIs during GPI precursor assembly. The presence of a fourth mannose in GPI is essential in fungi.
Database Links
Protein Families
Glycosyltransferase 22 family, PIGZ subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Gibberella zeae GPI mannosyltransferase 4 (SMP3) and what is its main function?

SMP3 in Gibberella zeae (Fusarium graminearum) is an enzyme involved in the glycosylphosphatidylinositol (GPI) biosynthesis pathway. It functions primarily as a mannosyltransferase that catalyzes the addition of a fourth mannose to GPI precursors during their biosynthesis . The protein is encoded by the SMP3 gene (also identified as FG06923 in ORF nomenclature) and is part of the essential cellular machinery that creates GPI anchors, which are crucial for attaching certain proteins to the cell membrane .

Methodologically, researchers investigate SMP3 function through complementation studies with homologous genes from other organisms, gene knockout experiments, and biochemical assays measuring mannosyltransferase activity.

What is known about SMP3 conservation across fungal species and other organisms?

SMP3 represents a conserved enzyme family found across fungi, animals, and other eukaryotes. Studies have demonstrated functional conservation between fungal and human SMP3 proteins. The human SMP3 homolog can complement defects in yeast smp3 mutants, indicating remarkable functional conservation despite evolutionary distance .

Expression patterns differ significantly between organisms. In humans, SMP3 shows tissue-specific expression with highest levels in brain and colon tissues, while showing minimal expression in many cultured cell lines . This contrasts with the apparently constitutive expression in fungi like Gibberella zeae.

Comparative genomic analyses provide a methodology for identifying conserved domains and species-specific features, offering insights into functional evolution of this enzyme family.

What role does SMP3 play in the pathogenicity of Gibberella zeae?

While direct evidence linking SMP3 to Gibberella zeae pathogenicity is limited in the provided research, the enzyme likely contributes to cell wall integrity and surface protein presentation—factors critical for fungal virulence . Gibberella zeae (Fusarium graminearum) is a significant pathogen causing head blight of wheat, oat, and barley, as well as ear and stalk rot of maize .

The genome of Fusarium graminearum contains regions with high sequence variability that are enriched for pathogenicity genes, secreted proteins, and clusters involved in secondary metabolism . Though SMP3's specific role in pathogenicity isn't explicitly detailed in the provided materials, its function in GPI anchor biosynthesis suggests it may affect the presentation of virulence factors on the cell surface.

Methodologically, pathogenicity contributions can be studied through targeted gene deletion, virulence assays on host plants, and transcriptomic analyses during infection stages.

What experimental approaches are most effective for studying recombinant SMP3 function?

Multiple complementary approaches can be employed to study recombinant SMP3:

  • Genetic complementation studies: Expression of Gibberella zeae SMP3 in yeast smp3 mutants to assess functional conservation, similar to studies performed with human SMP3 .

  • In vitro enzyme assays: Using purified recombinant SMP3 to measure mannosyltransferase activity with synthetic GPI precursors.

  • Structural biology approaches: X-ray crystallography or cryo-EM to determine protein structure.

  • Site-directed mutagenesis: To identify critical residues for catalytic activity and substrate binding.

  • Expression systems optimization: For recombinant protein production, considering:

Expression SystemAdvantagesChallenges
E. coliHigh yield, simple cultivationPotential lack of post-translational modifications
YeastEukaryotic processing, GPI pathway presentLower yields than bacterial systems
Insect cellsGood for membrane proteinsMore complex cultivation requirements
Mammalian cellsNative-like processingHigh cost, technical complexity

How can heterologous expression systems be optimized for SMP3 production?

Optimizing heterologous expression of membrane-bound glycosyltransferases like SMP3 requires addressing several challenges:

  • Codon optimization: Adapting the coding sequence to the codon preference of the expression host to enhance translation efficiency.

  • Expression vector selection: Testing promoters with different strengths and induction mechanisms to control expression levels.

  • Fusion tags approach: Strategic placement of purification and solubility tags:

    • N-terminal tags may interfere less with the C-terminal catalytic domain

    • Cleavable tags allow post-purification removal

    • Solubility-enhancing tags (SUMO, MBP) may improve folding

  • Membrane fraction handling: Specialized protocols for extracting and purifying membrane proteins while maintaining native conformation and activity.

  • Host cell engineering: Modifying the expression host to supply necessary cofactors or chaperones.

The recombinant Gibberella zeae SMP3 commercially available is produced at quantities of 50 μg and stored in Tris-based buffer with 50% glycerol , suggesting these conditions help maintain stability.

What analytical methods are essential for characterizing recombinant SMP3 activity?

Comprehensive characterization of recombinant SMP3 requires multiple analytical approaches:

  • GPI precursor analysis:

    • Radiolabeling studies with [3H]mannose

    • Mass spectrometry to determine glycan structures

    • Thin-layer chromatography of lipid-linked oligosaccharides

  • Enzyme kinetics determination:

    • Substrate affinity (Km) measurement

    • Catalytic efficiency (kcat/Km) calculation

    • Inhibition studies to identify reaction mechanisms

  • Interaction studies:

    • Pull-down assays to identify protein partners

    • Surface plasmon resonance for binding kinetics

    • Blue native PAGE to identify protein complexes

  • Subcellular localization:

    • Immunofluorescence microscopy with anti-SMP3 antibodies

    • Fractionation studies followed by Western blotting

    • Fusion with fluorescent proteins for live-cell imaging

Human SMP3 has been shown to localize to the endoplasmic reticulum, which would be the expected location for fungal SMP3 as well, given the conservation of the GPI biosynthesis pathway .

How does SMP3 function relate to GPI anchor structure diversity across species?

The GPI anchor structure shows interesting species-specific variations, particularly regarding the fourth mannose addition:

  • Species variability:

    • In Saccharomyces cerevisiae, fourth mannose addition is essential

    • In mammals, it appears to be tissue-specific and non-essential in many cell types

    • In Gibberella zeae, its precise role remains to be fully characterized

  • Functional implications:

    • The human SMP3 homolog adds a fourth mannose to certain Man3-GPIs during biosynthesis

    • When expressed in HeLa cells (which normally express minimal SMP3), human SMP3 causes abundant formation of tetramannosyl-GPIs

    • This suggests the possibility of regulated GPI anchor diversity in different tissues

  • Analytical approaches:

    • Comparative glycomics between species

    • Functional complementation studies

    • Mass spectrometry profiling of GPI anchors

This diversity may reflect adaptation to different environmental challenges or cellular needs across species and tissues.

What is the relationship between SMP3 and virulence in Gibberella zeae?

While direct studies on SMP3's role in Gibberella zeae virulence are not explicitly detailed in the provided materials, related research on G proteins in this organism provides a framework for investigating SMP3's potential contribution:

  • Virulence factor presentation: SMP3-dependent GPI anchoring likely affects the display of virulence factors on the fungal surface.

  • G protein signaling connection: Studies show that certain G protein subunits (specifically GzGPA2 and GzGPB1) are critical for pathogenicity in Gibberella zeae . The table below shows virulence relationships:

StrainRelative VirulenceGrowth Rate
Wild-type GZ3639100%100%
ΔGzGPA1Similar to wild-typeSlightly reduced
ΔGzGPA2Significantly reducedSlightly reduced
ΔGzGPA3Similar to wild-typeSlightly reduced
ΔGzGPB1Significantly reduced75% of wild-type
  • Research approaches:

    • SMP3 gene deletion studies with subsequent virulence testing

    • Transcriptomic analysis during infection

    • Comparative proteomics of GPI-anchored proteins between wild-type and SMP3 mutants

How can genomic approaches enhance our understanding of SMP3 function?

Genomic approaches offer powerful tools for investigating SMP3 function:

  • SNP analysis: The Fusarium graminearum genome shows regions of high SNP density that correspond with telomeric regions and central chromosomal regions . Genes associated with pathogenicity, including those unique to F. graminearum, secreted proteins, and gene clusters involved in secondary metabolism, are enriched in these high SNP regions .

  • Comparative genomics: Analyzing SMP3 genes across fungal species can reveal:

    • Conserved catalytic domains

    • Species-specific regulatory elements

    • Evolutionary patterns relating to pathogenicity

  • Transcriptomic profiling: RNA-seq during different growth phases and infection stages can reveal:

    • Temporal expression patterns of SMP3

    • Co-regulated genes that may function in the same pathway

    • Host-induced changes in expression

  • Functional genomics tools:

    • CRISPR-Cas9 for precise gene editing

    • RNAi for targeted knockdown

    • Random mutagenesis combined with phenotypic screening

These approaches can place SMP3 within larger genomic and metabolic contexts relevant to fungal biology and pathogenicity.

What challenges exist in developing SMP3-targeted antifungal strategies?

Developing antifungal strategies targeting SMP3 presents several research challenges:

  • Specificity considerations:

    • Functional conservation with human homologs may limit selectivity

    • Need to identify fungal-specific structural features of SMP3

  • Pathway redundancy:

    • Alternative glycosylation pathways may compensate for SMP3 inhibition

    • Understanding the complete GPI biosynthesis network is crucial

  • Drug delivery barriers:

    • Cell wall permeability issues for targeting membrane-bound enzymes

    • Field application challenges for agricultural fungicides

  • Resistance development:

    • Potential for rapid evolution of resistance due to high SNP density in pathogenicity-related genomic regions

    • Need for combination approaches targeting multiple pathways

  • Experimental approaches:

    • High-throughput screening for inhibitors

    • Structure-based drug design utilizing SMP3 models

    • In vivo efficacy testing in plant infection models

What are the optimal conditions for assaying recombinant SMP3 enzymatic activity?

Determining optimal conditions for SMP3 activity requires systematic evaluation of:

  • Buffer composition:

    • pH optimization (typically 6.5-7.5 for ER-resident enzymes)

    • Ionic strength requirements

    • Divalent cation dependencies (Mn2+, Mg2+)

  • Substrate considerations:

    • Synthetic vs. native GPI precursors

    • Concentration ranges for kinetic studies

    • Dolichol-phosphate-mannose as mannose donor

  • Detergent selection:

    • Critical for maintaining membrane protein solubility

    • Typical options include digitonin, DDM, or CHAPS

    • Concentration optimization to maintain activity while preventing aggregation

  • Storage conditions:
    The commercially available recombinant SMP3 is stored in Tris-based buffer with 50% glycerol , suggesting these conditions help maintain stability. Additional considerations include:

    • Temperature sensitivity (-20°C or -80°C for long-term)

    • Freeze-thaw cycle effects

    • Additives for stability enhancement

  • Activity detection methods:

    • Radiochemical assays with labeled substrates

    • Mass spectrometry of reaction products

    • Coupled enzyme assays for high-throughput screening

How can protein-protein interactions involving SMP3 be effectively studied?

Investigating SMP3's protein interaction network requires specialized approaches for membrane proteins:

  • In vivo approaches:

    • Proximity labeling techniques (BioID, APEX)

    • Split-reporter systems (BiFC, FRET)

    • Yeast two-hybrid adaptations for membrane proteins

  • In vitro methods:

    • Co-immunoprecipitation with specific antibodies

    • Pull-down assays using tagged recombinant proteins

    • Surface plasmon resonance for quantitative interaction measurements

  • Crosslinking strategies:

    • Photo-activatable or chemical crosslinkers

    • Mass spectrometry analysis of crosslinked complexes

    • In-cell crosslinking to capture physiological interactions

  • Computational prediction:

    • Sequence-based interaction prediction

    • Structural modeling of protein complexes

    • Network analysis based on co-expression data

These approaches can reveal interactions between SMP3 and other components of the GPI biosynthesis machinery, potentially identifying novel regulatory mechanisms.

What transcriptional and post-translational regulations affect SMP3 expression and function?

Understanding SMP3 regulation requires investigation at multiple levels:

  • Transcriptional regulation:

    • Promoter analysis for transcription factor binding sites

    • ChIP-seq to identify DNA-protein interactions

    • Reporter gene assays to measure promoter activity under different conditions

  • Post-transcriptional control:

    • mRNA stability and half-life measurements

    • Alternative splicing assessment

    • miRNA regulation potential

  • Post-translational modifications:

    • Phosphorylation sites identification (phosphoproteomics)

    • Glycosylation analysis

    • Ubiquitination and degradation pathways

  • Protein localization regulation:

    • ER retention signal functionality

    • Trafficking pathways analysis

    • Stress-induced relocalization potential

In humans, SMP3 expression appears to be tissue-specific, with highest levels in brain and colon, while being nearly absent from cultured cell lines . This suggests complex transcriptional regulation that may also occur in fungal systems under different environmental conditions.

How can CRISPR-Cas9 be applied to study SMP3 function in Gibberella zeae?

CRISPR-Cas9 technology offers precise genome editing capabilities for studying SMP3:

  • Gene knockout strategies:

    • Complete gene deletion to study loss-of-function phenotypes

    • Conditional knockout systems for essential genes

    • Homology-directed repair templates design

  • Domain analysis:

    • Precise editing of catalytic domains

    • Introduction of point mutations to study structure-function relationships

    • Creation of truncated variants

  • Promoter engineering:

    • Modification of endogenous promoter

    • Integration of inducible promoters

    • Creation of reporter fusions

  • Multiplexed editing:

    • Targeting multiple genes in GPI biosynthesis pathway

    • Creating double mutants to study genetic interactions

    • Combinatorial editing to identify synthetic lethality

  • Practical considerations:

    • Transformation protocols optimization for Gibberella zeae

    • gRNA design for maximum efficiency and specificity

    • Screening strategies for successful edits

CRISPR-based studies can provide insights into SMP3 function that were previously difficult to obtain through traditional genetic approaches.

How does SMP3 function in Gibberella zeae compare to other fungal pathogens?

Comparative analysis of SMP3 across fungal pathogens reveals important similarities and differences:

  • Functional conservation:

    • The fundamental role in adding the fourth mannose to GPI anchors appears conserved

    • Essentiality varies between species (essential in S. cerevisiae, status in G. zeae to be determined)

  • Structural variations:

    • Sequence divergence in non-catalytic regions

    • Species-specific domains that may confer specialized functions

    • Variations in transmembrane topology

  • Pathogenicity contributions:

    • In Candida albicans, GPI-anchored proteins are critical virulence factors

    • Cryptococcus neoformans shows distinct GPI anchor structures

    • Aspergillus species utilize GPI-anchored enzymes for cell wall remodeling

  • Regulatory differences:

    • Species-specific transcriptional control

    • Differential responses to environmental stresses

    • Varied integration with signaling pathways

This comparative approach can identify conserved elements as potential broad-spectrum antifungal targets versus species-specific features for targeted interventions.

What insights can be gained from comparing fungal and human SMP3 homologs?

The functional conservation between fungal and human SMP3 proteins offers valuable research opportunities:

  • Structural comparison:

    • Human SMP3 can complement yeast smp3 mutants, indicating conserved catalytic function

    • Sequence divergence analysis can identify fungal-specific regions

    • Homology modeling based on any available crystal structures

  • Expression pattern differences:

    • Human SMP3 shows tissue-specific expression (highest in brain and colon)

    • Nearly absent in cultured human cell lines compared to constitutive expression in fungi

    • Suggests evolved regulatory mechanisms

  • Functional distinctions:

    • In humans, the fourth mannose addition appears non-essential in many cell types

    • In yeast, SMP3 function is essential for viability

    • Overexpression of human SMP3 in HeLa cells causes abundant formation of tetramannosyl-GPIs

  • Therapeutic implications:

    • Identifying fungal-specific features for selective targeting

    • Understanding shared features to predict potential side effects

    • Structure-based design of inhibitors with selectivity for fungal enzymes

This comparative approach is valuable for both basic science understanding and applied antifungal development.

What are the best methods for purifying recombinant SMP3 while maintaining enzymatic activity?

Purifying active membrane-bound enzymes like SMP3 requires specialized approaches:

  • Expression system selection:

    • Considerations for proper folding and post-translational modifications

    • Scale-up potential for sufficient yield

    • Codon optimization for the chosen host

  • Solubilization strategies:

    • Detergent screening panel (non-ionic, zwitterionic, and mild ionic detergents)

    • Detergent concentration optimization

    • Amphipol or nanodisc reconstitution for long-term stability

  • Purification workflow:

StepMethodConsiderations
Initial captureAffinity chromatographyTag position to avoid interference with activity
IntermediateIon exchangeBuffer compatibility with activity
PolishingSize exclusionDetecting and removing aggregates
Quality controlActivity assaySubstrate accessibility in detergent
  • Stability enhancement:

    • Glycerol addition (as seen in commercial preparations)

    • Lipid supplementation

    • Specific buffer components (reducing agents, protease inhibitors)

  • Activity verification:

    • Functional assays at multiple purification stages

    • Thermal shift assays to assess folding

    • Limited proteolysis to verify proper conformation

What imaging techniques are most informative for studying SMP3 localization and dynamics?

Advanced imaging approaches provide crucial insights into SMP3 biology:

  • Fixed cell microscopy:

    • Immunofluorescence with specific antibodies

    • Co-localization with ER markers

    • Super-resolution techniques (STORM, STED) for detailed localization

  • Live cell imaging:

    • Fluorescent protein fusions (if functional)

    • Photoactivatable or photoconvertible tags for pulse-chase

    • FRAP (Fluorescence Recovery After Photobleaching) for mobility studies

  • Correlative techniques:

    • CLEM (Correlative Light and Electron Microscopy)

    • Immuno-EM for precise subcellular localization

    • Cryo-electron tomography for structural context

  • Dynamic studies:

    • Time-lapse imaging during various cellular processes

    • Stress response visualization

    • Infection-induced changes in localization

Human SMP3 has been shown to localize to the endoplasmic reticulum , providing a starting point for comparative studies in Gibberella zeae.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.