Recombinant Gibberella zeae Mitochondrial import inner membrane translocase subunit TIM21 (TIM21)

Shipped with Ice Packs
In Stock

Description

Introduction

The Gibberella zeae Mitochondrial Import Inner Membrane Translocase Subunit TIM21 (TIM21) is a component of the protein translocation machinery in mitochondria. Mitochondria, essential organelles in eukaryotic cells, require the import of numerous proteins synthesized in the cytoplasm for their function and maintenance . The translocase of the inner membrane (TIM) complexes facilitate the import of these proteins across the mitochondrial inner membrane . Specifically, TIM21 is a subunit of the TIM23 complex, which is crucial for translocating proteins containing transit peptides into the mitochondrial matrix .

Interactions with Other Proteins and Complexes

Tim21 interacts with several key components of the mitochondrial protein import machinery and respiratory chain .

  • TOM Complex: Tim21 connects the translocase of the outer membrane (TOM) complex to the TIM23 complex . It binds to the intermembrane space domain of the Tom22 receptor, facilitating the transfer of preproteins from the outer to the inner membrane .

  • TIM23 Complex: As a core component of the TIM23 complex, Tim21 plays a direct role in importing and inserting proteins into the inner membrane . It interacts physically with components of the TIM17:23 complex .

  • Respiratory Chain Complexes: Tim21 associates with respiratory chain complexes, including Complex I and Complex III . These interactions suggest a role in the import and biogenesis of respiratory chain components .

Research Findings and Experimental Evidence

Several studies have provided evidence for the function and interactions of Tim21.

  • Structure Determination: The structure of the Tim21 binding domain from Saccharomyces cerevisiae was determined at 1.6 Å resolution, revealing a novel α/β-protein fold . This structure provided insights into how Tim21 interacts with Tom22 .

  • Binding to Tom22: Research has shown that Tim21 binds to a 17-residue segment of Tom22, with negatively charged residues in Tom22 being crucial for this interaction . This electrostatic interaction is supported by the observation that positively charged presequences compete with Tim21 for binding to Tom22 .

  • Functional Studies in Arabidopsis thaliana: Studies on Arabidopsis thaliana have identified two novel Tim21-like proteins (AtTim21-like 1 and AtTim21-like 2) that are imported into the mitochondrial inner membrane . These proteins associate with respiratory chain Complex I and III and the TIM17:23 translocase . Deletion of AtTim21 results in early seedling lethality, underscoring its importance in plant mitochondrial function . Overexpression of AtTim21 leads to increased cell numbers, cell size, and ATP production and upregulates the transcript abundance of complex III, IV, and ATP synthase subunits .

  • Role in Protein Insertion: Tim21 is involved in the import and insertion of proteins into the inner membrane, but not in the translocation of matrix-located proteins .

Implications for Mitochondrial Biogenesis and Function

Tim21 plays a crucial role in mitochondrial biogenesis and function by coordinating the import of proteins and the assembly of respiratory chain complexes . Its interactions with both the TOM and TIM complexes facilitate the efficient transfer of preproteins into the mitochondria . The association of Tim21 with respiratory chain complexes suggests that it is involved in the biogenesis of these complexes, ensuring the proper assembly and function of the electron transport chain .

Tables

Table 1: Interactions of Tim21

Interacting PartnerDescription
Tom22Receptor protein in the TOM complex; Tim21 binds to the intermembrane space domain of Tom22 .
TIM17:23 ComplexTranslocase of the inner membrane; Tim21 is a core component and facilitates protein import into the inner membrane .
Respiratory Chain ComplexesSpecifically, Complex I and Complex III; Tim21 assists in the import and biogenesis of respiratory chain components .

Table 2: Functional Differences Between TIM Complex Forms

Complex FormComponentsFunction
TIMMOTORTim17, Tim23, Tim44, Pam16, Pam18, mtHsp70Translocation of soluble matrix-targeted proteins
TIMSORTTim17, Tim23, Tim21, Mgr2Integration of membrane proteins into the inner mitochondrial membrane

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TIM21; FGRRES_09713; FGSG_09713; Mitochondrial import inner membrane translocase subunit TIM21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-229
Protein Length
Full Length of Mature Protein
Species
Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)
Target Names
TIM21
Target Protein Sequence
ATQQGLGATPRGPKRRAVTPFNDNGHVPWKQLSVAEKAARATQQSFNFGMILVGLMLTGG VGYFLWTDVFSPDSKISNFNRAVDKIRSDPRIIDVMGDSKKIAAHGDETFNKWRRARPVA SSETTDARGDQHIMMHFYVEGPKNNGVARLHMIKYRGHSDFEYKYLFVDVKDHERIYLEH EDSSSKNGKKFSLFGVKW
Uniprot No.

Target Background

Function

Recombinant Gibberella zeae Mitochondrial import inner membrane translocase subunit TIM21 (TIM21) is an essential component of the TIM23 complex. This complex facilitates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. TIM21 is required to maintain close contact between the TOM and TIM23 complexes. Following this interaction, TIM21 is released from the TOM23 complex, enabling protein translocation into the mitochondrial matrix.

Database Links
Protein Families
TIM21 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Gibberella zeae TIM21 and what is its biological significance?

Gibberella zeae TIM21 is a mitochondrial protein that functions as a component of the inner membrane translocase. It is part of the presequence translocase of the inner membrane (TIM23 complex) in the fungal species Gibberella zeae, which is also known as Fusarium graminearum in its asexual stage . TIM21 is anchored in the mitochondrial inner membrane by a single transmembrane domain and exposes its C-terminal domain into the intermembrane space . The protein plays a crucial role in the formation of translocation contact sites between the outer and inner mitochondrial membranes, facilitating protein import into mitochondria . Given that G. zeae is a devastating pathogen of cereals, especially wheat and barley, understanding the role of its proteins may provide insights into pathogenicity mechanisms .

How does TIM21 function in mitochondrial protein import?

TIM21 functions by binding to the translocase of the outer membrane (TOM complex) through its C-terminal domain, which is exposed to the intermembrane space. This binding keeps the two translocases (TOM and TIM23) in close contact, facilitating the coordinated movement of preproteins from the outer membrane to the inner membrane . TIM21's interaction with the TOM complex occurs at the trans site, effectively creating a continuous channel for protein translocation across both mitochondrial membranes . The protein does not appear to bind to other components of the TIM23 complex but specifically interacts with the TOM complex, suggesting a specialized role in coordinating the two translocase systems .

What is the relationship between Gibberella zeae and Fusarium graminearum?

Gibberella zeae is the sexual (teleomorph) stage of Fusarium graminearum, which is the asexual (anamorph) stage of this fungal organism . This fungus is a haploid homothallic ascomycete that causes Fusarium Head Blight (FHB), a devastating disease affecting wheat, barley, and other cereal crops worldwide . The pathogen produces fruiting bodies called perithecia that develop on mycelium and release ascospores, which serve as primary inocula for infection . The fungus is responsible for billions of dollars in economic losses annually due to reduced grain yield and contamination with mycotoxins, primarily deoxynivalenol (DON) and zearalenone, which are harmful to humans and livestock .

How does the structure of Gibberella zeae TIM21 differ from homologous proteins in other organisms?

Recombinant G. zeae TIM21 (TIM21) has a sequence of 198 amino acids spanning positions 32-229 of the full protein . Unlike Tim21 proteins in other organisms, Arabidopsis studies have identified two novel Tim21-like proteins (AtTim21-like 1 and AtTim21-like 2) that share functional similarities but show distinct characteristics . When imported into mitochondria, AtTim21-like 1 and AtTim21-like 2 have apparent molecular masses of 27 kDa and 30 kDa respectively, compared to the 27 kDa of AtTim21 . G. zeae TIM21 contains a transmembrane domain that anchors it to the inner mitochondrial membrane, with its C-terminal domain extending into the intermembrane space, a structural feature that appears conserved across species .

What interactions does TIM21 have with respiratory chain complexes and how do these affect mitochondrial function?

Studies have shown that Tim21 not only interacts with the protein import machinery but also associates with respiratory chain complexes. In yeast, Tim21 physically associates with components of the TIM17:23 complex and respiratory subunits of complexes III and IV . Similarly, in Arabidopsis, AtTim21 and AtTim21-like proteins interact with TIM17:23 and associate with Complex I, Complex III, and the supercomplex of Complexes I and III .

These interactions suggest that Tim21 plays a role in coordinating protein import with respiratory chain assembly and function. Overexpression of AtTim21 in Arabidopsis resulted in increased cell numbers, cell size, and ATP production, along with upregulation of transcripts for subunits of respiratory complexes III and IV and ATP synthase . This indicates that Tim21 may be involved in the biogenesis and regulation of respiratory chain components, potentially linking mitochondrial protein import to respiratory function .

How does the Tim21 complex in G. zeae relate to the fungal pathogenicity and mycotoxin production?

While direct evidence linking TIM21 specifically to G. zeae pathogenicity is limited in the provided sources, there are indications of potential relationships between mitochondrial function and fungal virulence. G. zeae produces various mycotoxins, including trichothecenes (particularly deoxynivalenol/DON) and zearalenone, which contribute to its pathogenicity . The production of these mycotoxins is regulated by TRI genes .

Studies on related mitochondrial processes in F. graminearum have shown that proper mitotic regulation via proteins such as the small GTPase FgTem1 is essential for fungal development and pathogenicity . FgTem1 regulates the formation of infection structures and invasive hyphal growth on wheat tissues, and disruption of mitotic exit regulation dramatically affects trichothecene biosynthesis gene expression . While not directly linked to TIM21, these findings suggest that proper mitochondrial function and cell cycle regulation are critical for the fungus's ability to cause disease and produce mycotoxins.

What are the most effective methods for recombinant expression and purification of G. zeae TIM21?

Based on experiences with similar proteins, recombinant expression of G. zeae TIM21 can be achieved using several expression systems:

  • E. coli expression system: Similar to the approach used for G. zeae lipase (GZEL), the gene encoding TIM21 can be cloned into an expression vector (such as pFL-B62cl) and expressed in E. coli strains optimized for protein folding, such as SHuffle T7 . This approach may require optimization to prevent inclusion body formation, which is a common challenge with mitochondrial proteins.

  • Pichia pastoris expression system: As demonstrated for GZEL, the gene can be ligated to vectors like pGAPZαA or pLIZG7 and transformed into P. pastoris KM71. While this system can produce active protein in the culture supernatant, it requires longer fermentation times (5-7 days) .

For purification, a multi-step approach is recommended:

  • Ni-NTA affinity chromatography for initial capture (if His-tagged)

  • Sephadex G-25 gel filtration for buffer exchange

  • DEAE ion-exchange chromatography for final purification

This combination of methods has yielded approximately 90 mg of purified recombinant protein per liter of culture for similar G. zeae proteins .

How can researchers validate the subcellular localization and membrane topology of TIM21?

To validate the subcellular localization and membrane topology of TIM21, researchers can employ multiple complementary approaches:

  • In vitro import assays: Radiolabeled TIM21 precursor can be incubated with isolated mitochondria. Import can be verified by observing a band of lower molecular weight (due to cleavage of the targeting peptide) that is protected from proteinase K digestion in intact mitochondria but not in the presence of membrane-disrupting agents like valinomycin .

  • GFP fusion and microscopy: The TIM21 gene can be fused with GFP and expressed in cells to visualize mitochondrial localization. This approach was successful for AtTim21-like proteins and confirmed their mitochondrial targeting .

  • Protease protection assays: To determine membrane topology, mitochondria containing imported TIM21 can be treated with proteinase K under various conditions:

    • Intact mitochondria: Only expose outer membrane proteins

    • Outer membrane disruption (e.g., osmotic shock): Expose intermembrane space domains

    • Complete membrane disruption: Expose all proteins

  • Blue Native PAGE (BN-PAGE): This technique can identify the protein complexes that TIM21 associates with, such as the TIM23 complex or respiratory chain complexes .

  • Yeast two-hybrid assays: These can be used to confirm protein-protein interactions between TIM21 and components of the TIM23 complex or TOM complex .

What analytical methods are optimal for studying TIM21's interactions with other mitochondrial complexes?

For comprehensive analysis of TIM21's interactions with other mitochondrial complexes, the following methods have proven effective:

  • Co-immunoprecipitation (Co-IP): High-throughput Co-IP can identify protein-protein interactions. This approach was successfully used to identify interactions between FgTem1 (another mitochondrial protein in F. graminearum) and its binding partners . For TIM21, antibodies against tagged versions of the protein can pull down interaction partners.

  • Blue Native PAGE (BN-PAGE): This technique separates protein complexes in their native state and can be combined with second-dimension SDS-PAGE to identify components. For AtTim21-like proteins, BN-PAGE revealed associations with Complex I, Complex III, and the TIM17:23 complex .

  • Protein crosslinking followed by mass spectrometry: Crosslinking agents can stabilize transient interactions, and mass spectrometry can identify the crosslinked peptides, providing information about interaction interfaces.

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC): These techniques can measure binding affinities between purified TIM21 and its interaction partners, providing quantitative data on interaction strengths.

  • Proximity-based labeling: Techniques like BioID or APEX2 can identify proteins in close proximity to TIM21 in vivo.

A typical experimental workflow might include:

  • Initial screening using Co-IP or proximity labeling

  • Validation of specific interactions using BN-PAGE

  • Quantification of binding parameters using SPR or ITC

  • Structural characterization of interaction interfaces using crosslinking-MS

What genetic manipulation strategies are most effective for studying TIM21 function in G. zeae?

To study TIM21 function in G. zeae, several genetic approaches can be employed:

The choice of method depends on the specific research question, but a combination of approaches is often most informative. When studying the effects on pathogenicity, it's important to assess relevant phenotypes such as growth on different media, conidiation, perithecia formation, and infection of host plants like wheat .

How can researchers design experiments to investigate the role of TIM21 in G. zeae pathogenicity?

To investigate the role of TIM21 in G. zeae pathogenicity, researchers should consider a multi-faceted experimental approach:

  • Genetic manipulation:

    • Generate TIM21 mutants with various levels of expression or specific domain mutations

    • Create GFP-tagged versions to track localization during infection

  • In vitro phenotypic assays:

    • Assess growth rates on different media

    • Evaluate conidiation and perithecial development

    • Measure mycotoxin production using GC-MS to quantify trichothecenes and zearalenone

    • Test for stress tolerance (oxidative, temperature, cell wall stressors)

  • Plant infection assays:

    • Point inoculation of wheat spikelets to assess disease progression

    • Spray inoculation to evaluate initial infection capability

    • Detached leaf assays for rapid screening

    • Coleoptile infection assays to study invasive hyphal growth

  • Molecular analyses:

    • RNAseq to compare transcriptomes of wild-type and TIM21 mutants during infection

    • qRT-PCR to measure expression of TRI genes and other virulence factors

    • Proteomics to identify changes in mitochondrial protein composition

  • Microscopy:

    • Confocal microscopy to track GFP-tagged TIM21 during host colonization

    • Transmission electron microscopy to examine mitochondrial morphology

A comprehensive experiment might involve creating a conditional TIM21 mutant, confirming its mitochondrial localization, measuring growth and development in vitro, assessing mycotoxin production, and then performing wheat infection assays with microscopic visualization of the infection process.

What controls and validation steps are essential when working with recombinant G. zeae TIM21?

When working with recombinant G. zeae TIM21, several controls and validation steps are essential to ensure reliable results:

  • Protein expression and purification:

    • Sequence verification of the expression construct

    • Western blot with anti-TIM21 antibodies or anti-tag antibodies to confirm identity

    • Mass spectrometry to verify protein sequence and post-translational modifications

    • Circular dichroism to assess proper protein folding

    • Size-exclusion chromatography to evaluate oligomerization state

  • Functional validation:

    • Import assays with radiolabeled preproteins to confirm TIM21's role in protein translocation

    • Complementation assays in TIM21-deficient systems

    • Binding assays with purified TOM complex components

  • Localization studies:

    • Multiple markers for mitochondrial compartments (matrix, inner membrane, intermembrane space)

    • Protease protection assays with and without membrane disruption

    • Controls with known proteins of defined topology (e.g., matrix-facing Tim44, intermembrane space-facing Tim50)

  • Interaction studies:

    • Negative controls (unrelated proteins) in co-immunoprecipitation experiments

    • Validation of interactions by multiple methods (e.g., yeast two-hybrid, BN-PAGE, co-IP)

    • Competition assays to confirm specificity of interactions

  • In vivo studies:

    • Multiple independent transformants to account for position effects

    • Complementation with wild-type TIM21 to confirm phenotype specificity

    • Appropriate wild-type and negative control strains in all experiments

How can researchers troubleshoot expression issues with recombinant G. zeae TIM21?

When encountering difficulties expressing recombinant G. zeae TIM21, researchers can implement the following troubleshooting strategies:

  • Inclusion body formation:

    • Try expression at lower temperatures (16-20°C)

    • Use specialized E. coli strains like SHuffle T7 that enhance disulfide bond formation

    • Co-express with molecular chaperones

    • Optimize induction conditions (IPTG concentration, time)

    • Consider fusion partners that enhance solubility (MBP, SUMO, Trx)

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Test different promoters and expression vectors

    • Adjust medium composition and growth conditions

    • Consider alternative expression hosts (P. pastoris, insect cells)

  • Protein degradation:

    • Add protease inhibitors during purification

    • Reduce expression time

    • Test different buffer compositions for stability

    • Identify and mutate protease-sensitive sites

  • Unsuccessful purification:

    • If using His-tags, check for accessible exposure of the tag

    • Try alternative tag positions (N-terminal vs. C-terminal)

    • Use different purification strategies (ion exchange, hydrophobic interaction)

    • Optimize elution conditions

  • Inactive protein:

    • Ensure proper redox environment for disulfide formation

    • Test different refolding protocols if purifying from inclusion bodies

    • Verify presence of required cofactors or metal ions

    • Consider membrane mimetics for this transmembrane protein (detergents, nanodiscs)

Based on experience with similar G. zeae proteins, a successful approach might involve:

  • Cloning into pFL-B62cl vector

  • Expression in E. coli SHuffle T7 strain

  • Induction at lower temperatures with reduced IPTG concentration

  • Purification using a combination of Ni-NTA, Sephadex G-25, and DEAE chromatography

How can understanding G. zeae TIM21 contribute to developing fungal disease control strategies?

Understanding G. zeae TIM21 could contribute to fungal disease control strategies in several ways:

  • Target identification: If TIM21 proves essential for fungal pathogenicity, it could become a target for antifungal development. Mitochondrial import is critical for cellular function, and disruption of this process could inhibit fungal growth.

  • Screening platforms: Recombinant TIM21 could be used to develop high-throughput screening assays for compounds that specifically disrupt fungal TIM21 function without affecting host mitochondrial import.

  • Resistance management: Understanding the role of TIM21 in fungal stress responses could provide insights into how fungi might develop resistance to current antifungals, enabling proactive resistance management strategies.

  • Biomarker development: If TIM21 expression or activity changes during infection, it could serve as a biomarker for early detection of Fusarium Head Blight.

  • Host-induced gene silencing: If TIM21 proves essential for pathogenicity, developing RNA interference strategies targeting TIM21 mRNA could be explored for transgenic crop protection.

The high conservation of mitochondrial import mechanisms suggests that targeting fungal-specific features of TIM21 might be necessary to avoid host toxicity. Detailed structural and functional comparisons between fungal and plant/animal TIM21 homologs will be crucial for this approach.

What are the potential applications of recombinant G. zeae TIM21 in biotechnology?

Recombinant G. zeae TIM21 could have several biotechnological applications:

  • Structural biology platform: The protein could serve as a model system for studying mitochondrial protein import in fungi, potentially revealing fungal-specific features that could be exploited in antifungal development.

  • Protein engineering: Understanding TIM21's role in coordinating protein import with respiratory chain assembly could inform the design of synthetic proteins that regulate mitochondrial function in biotechnologically relevant organisms.

  • Diagnostic tools: Antibodies against TIM21 could be developed for early detection of G. zeae infection in crops, potentially enabling timely intervention before symptoms appear.

  • Delivery systems: If TIM21's interaction with the TOM complex can be manipulated, it might be possible to design systems for delivering therapeutic molecules specifically to fungal mitochondria.

  • Agricultural biotechnology: Knowledge of TIM21 function could inform strategies for developing crops with enhanced resistance to G. zeae infection, either through traditional breeding or genetic engineering approaches.

The dual role of TIM21 in protein import and respiratory chain interactions makes it particularly interesting for applications seeking to modulate mitochondrial function in biotechnologically relevant organisms.

What key questions remain unanswered about G. zeae TIM21 and how might future research address them?

Several important questions about G. zeae TIM21 remain to be addressed:

  • Is TIM21 essential for G. zeae viability?

    • Future approach: Conditional knockout systems or degron-based protein depletion to systematically reduce TIM21 levels and assess viability thresholds

  • What is the atomic structure of G. zeae TIM21 and how does it differ from homologs?

    • Future approach: X-ray crystallography or cryo-electron microscopy of purified TIM21, potentially in complex with interaction partners

  • Does TIM21 function change during different stages of fungal infection?

    • Future approach: Stage-specific transcriptomics, proteomics, and in vivo imaging of tagged TIM21 during infection progression

  • What specific proteins are imported via the TIM21-dependent pathway in G. zeae?

    • Future approach: Comparative proteomics of mitochondria from wild-type and TIM21-depleted strains

  • How does TIM21 coordinate with the fungal cell cycle and stress responses?

    • Future approach: Investigation of relationships between TIM21 and cell cycle regulators like FgTem1 , particularly during host infection

  • Does TIM21 play a role in mycotoxin production?

    • Future approach: Detailed analysis of trichothecene biosynthesis gene expression and mycotoxin production in TIM21 mutants

  • Are there fungal-specific features of TIM21 that could be targeted for disease control?

    • Future approach: Comparative analysis of TIM21 sequences and structures across fungal pathogens and host organisms to identify unique features

Addressing these questions will require integrating structural biology, functional genomics, proteomics, and plant pathology approaches to build a comprehensive understanding of this important protein's role in fungal biology and pathogenicity.

How does G. zeae TIM21 compare to homologous proteins in other fungal pathogens?

G. zeae TIM21 shares functional similarities with TIM21 proteins from other fungal species, but with some notable differences that may relate to pathogenicity. While detailed comparative data specifically for G. zeae TIM21 is limited in the provided sources, broader patterns can be inferred:

Future comparative genomics and functional studies comparing G. zeae TIM21 with homologs from other Fusarium species and more distantly related fungal pathogens would provide valuable insights into how this protein may have evolved in relation to pathogenicity.

What insights can be gained from comparisons between fungal and plant TIM21 proteins?

Comparing fungal and plant TIM21 proteins reveals intriguing evolutionary and functional insights:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.