Recombinant Gibberella zeae Mitochondrial import inner membrane translocase subunit TIM50 (TIM50)

Basic Research Questions

• What is the structure and function of TIM50 in Gibberella zeae?

  TIM50 in Gibberella zeae (Fusarium graminearum) is a mitochondrial import inner membrane translocase subunit that spans the inner membrane with a single transmembrane segment and exposes a large hydrophilic domain in the intermembrane space . Functionally, TIM50 plays a crucial role in the transfer of preproteins from the translocase of the outer membrane (TOM complex) to the TIM23 complex through the intermembrane space . The protein consists of 525 amino acids with a recommended expression region of residues 46-525 . The protein contains multiple functional domains including a hydrophobic transmembrane region and several conserved motifs that are essential for its preprotein binding and translocation activities.

• What are the optimal storage conditions for recombinant G. zeae TIM50 protein?

  For optimal stability and activity, recombinant Gibberella zeae TIM50 protein should be stored in a Tris-based buffer with 50% glycerol . The recommended storage temperature is -20°C, with -80°C being suitable for extended storage periods . To prevent protein degradation, repeated freezing and thawing should be avoided. For shorter-term work (up to one week), working aliquots can be maintained at 4°C . This storage protocol helps maintain the native conformation and functional properties of the protein for experimental applications.

• How can researchers confirm the identity and purity of recombinant TIM50?

  Methodological approach to confirming identity and purity includes:

  • SDS-PAGE analysis to verify the molecular weight (approximately 55-60 kDa)

  • Western blotting using specific antibodies against TIM50 or epitope tags

  • Mass spectrometry for peptide fingerprinting

  • Circular dichroism to assess secondary structure integrity

  • Functional assays to confirm biological activity

  For optimal results, researchers should perform at least three independent analytical methods, with mass spectrometry being particularly valuable for confirming sequence identity matching the expected amino acid sequence: SKRSSGQPPKESKKKPSQAQNDAEAAKTPEKPAENDVNKASEQSPEAPKEGEQIPFHKLP DLTQGIPSTLFEEMGGDKKKEQQALQELEEAESKGNERDRSEYVSTSERNRKWWTRFmLT AVAAGGTLSLLYMGRNWEDTIEAERHSDSPNGPSPSLWWKRAKARMTESVTYYQEPAFEK LLPDPDPTFERPYTLCLSLDDLLIHSEWTREHGWRIAKRPGVDYFIRYLSQYYELVLFTT TPYATGEPVMRKLDPFRLILWPLYREATKFEDGEIVKDLSYLNRDLSKVIIIDTKAKHVR NQPDNAIILDPWKGDKDDKNLVNLIPFLEYIHTMQYSDVRKVIKSFDGKDIPTEFARREA IARKEFQAKQLTHKHKHGSGVGALGNmLGLKPSNMNMMVSPDGEQNPAEAFAQGKmLQDV ARERGQRNYMELEKQIRENGEKWLKEEAAMMEAAQKEAMNSMMGSFGGWFGGNNPPEKKA .

• What experimental systems are suitable for studying TIM50 function?

  Several experimental systems can be employed to study TIM50 function:

  • In vitro reconstitution systems using purified components

  • Isolated mitochondria from G. zeae or model organisms

  • Yeast complementation studies (particularly in S. cerevisiae)

  • Neurospora crassa models (which have been successfully used for TIM complex studies)

  • Heterologous expression systems in bacterial or insect cells

  For direct functional analysis, isolated mitochondria from G. zeae coupled with in vitro import assays provide the most physiologically relevant system. Cross-linking experiments with halted preproteins have proven particularly effective for identifying TIM50's interactions during protein translocation .

• How does G. zeae TIM50 compare with homologs in other fungal species?

  While maintaining core functional domains, TIM50 shows notable variation across fungal species:

  Species	Sequence Similarity to G. zeae TIM50	Key Structural Differences	Functional Conservation
  N. crassa	~65-70% identity	Extended intermembrane space domain	High functional conservation
  S. cerevisiae	~40-45% identity	Shorter C-terminal region	Essential for viability
  A. nidulans	~60-65% identity	Variation in phosphorylation sites	Presumed similar function
  F. oxysporum	~90-95% identity	Nearly identical	Presumed identical function

  Comparative functional analysis between G. zeae, G. moniliformis, and F. oxysporum has been suggested as valuable for understanding evolutionary divergence of gene function in these related species .

Advanced Research Questions

Experimental Techniques and Protocols

• What are the most effective methods for purifying native TIM23 complex containing TIM50 from G. zeae?

  The isolation of intact TIM23 complex requires specialized techniques:

  1. Gentle solubilization protocol:

     • Mitochondria isolation using differential centrifugation

     • Solubilization with digitonin (0.5-1%) or mild non-ionic detergents

     • Immediate stabilization with protease inhibitor cocktail

  2. Affinity chromatography approaches:

     • Tagged version of TIM23 or TIM17 as bait

     • Sequential purification steps (ion exchange followed by size exclusion)

     • Native elution conditions to maintain complex integrity

  3. Validation of complex composition:

     • Blue native PAGE to assess complex size and stability

     • Western blotting for all known subunits

     • Mass spectrometry to identify all components and post-translational modifications

  This methodology has been successfully applied in Neurospora crassa and can be adapted for G. zeae with appropriate modifications to account for species-specific differences in membrane composition and complex stability.

• How can researchers effectively characterize TIM50's phosphorylation status and its impact on function?

  Comprehensive characterization of TIM50 phosphorylation requires:

  1. Phosphoproteomic analysis:

     • Enrichment of phosphopeptides using TiO₂ or IMAC

     • MS/MS analysis with neutral loss scanning

     • Site-specific quantification using label-free or iTRAQ/TMT approaches

  2. Functional assessment of phosphosites:

     • Site-directed mutagenesis (S/T→A for loss, S/T→D/E for mimicry)

     • In vitro kinase assays to identify responsible kinases

     • Import assays with phosphomimetic variants

  3. Temporal dynamics analysis:

     • Pulse-chase phospholabeling

     • Phosphorylation changes during different growth phases

     • Response to stress conditions or infection-related signals

  The impact on function should be assessed using structural analysis to predict how phosphorylation alters binding interfaces, followed by experimental validation using preprotein binding assays and import kinetics measurements.

• What approaches can be used to study how TIM50 coordinates with other translocases in G. zeae?

  Investigating the coordination between TIM50 and other translocases requires:

  1. Proximity-based interactome mapping:

     • BioID or APEX2 fusion proteins for proximity labeling

     • Split-GFP complementation assays

     • FRET/FLIM analysis between labeled translocase components

  2. Reconstitution of translocation pathways:

     • Liposome-reconstituted systems with purified components

     • Sequential addition assays to determine order of events

     • Single-molecule tracking of preprotein movement

  3. Kinetic modeling of protein translocation:

     • Mathematical modeling of import rates with variable component levels

     • Identification of rate-limiting steps

     • Simulation of effects of component alterations

  These approaches have successfully demonstrated that TIM50 plays a crucial role in the transfer of preproteins from the TOM complex to the TIM23 complex through the intermembrane space , suggesting a coordinating function that could be further characterized in G. zeae using these methods.

• How does the amino acid sequence of G. zeae TIM50 contribute to its specific functions?

  Structure-function analysis of TIM50 amino acid sequence requires:

  1. Comparative sequence analysis across species:

     • Multiple sequence alignment to identify conserved motifs

     • Identification of G. zeae-specific regions

     • Evolutionary rate analysis to detect positive selection

  2. Domain mapping through truncation and chimera studies:

     • Systematic truncation constructs

     • Domain swapping with homologs from other species

     • Complementation assays to assess functional equivalence

  3. Structural prediction and validation:

     • Ab initio or homology modeling

     • Limited proteolysis to identify domain boundaries

     • Hydrogen-deuterium exchange mass spectrometry for flexible regions

  The complete amino acid sequence of G. zeae TIM50 (SKRSSGQPPKESKKKPSQAQNDAEAAKTPEKPAENDVNKASEQSPEAPKEGEQIPFHKLP DLTQGIPSTLFEEMGGDKKKEQQALQELEEAESKGNERDRSEYVSTSERNRKWWTRFmLT AVAAGGTLSLLYMGRNWEDTIEAERHSDSPNGPSPSLWWKRAKARMTESVTYYQEPAFEK LLPDPDPTFERPYTLCLSLDDLLIHSEWTREHGWRIAKRPGVDYFIRYLSQYYELVLFTT TPYATGEPVMRKLDPFRLILWPLYREATKFEDGEIVKDLSYLNRDLSKVIIIDTKAKHVR NQPDNAIILDPWKGDKDDKNLVNLIPFLEYIHTMQYSDVRKVIKSFDGKDIPTEFARREA IARKEFQAKQLTHKHKHGSGVGALGNmLGLKPSNMNMMVSPDGEQNPAEAFAQGKmLQDV ARERGQRNYMELEKQIRENGEKWLKEEAAMMEAAQKEAMNSMMGSFGGWFGGNNPPEKKA) provides the foundation for these analyses.

• What methods can be used to investigate the role of TIM50 in cellular response to environmental stress?

  To investigate TIM50's role in stress response:

  1. Stress-specific transcriptional and proteomic profiling:

     • Compare wild-type and TIM50-depleted strains under:

       • Oxidative stress (H₂O₂, menadione)

       • Heat shock

       • Osmotic stress

       • Fungicide exposure

     • Identify differentially regulated pathways

  2. Mitochondrial function under stress conditions:

     • Measure membrane potential changes

     • Quantify protein import rates under stress

     • Assess mitochondrial morphology changes

  3. Genetic interaction screens:

     • Synthetic genetic array analysis with stress response genes

     • Chemical-genetic profiling using stress-inducing compounds

     • Suppressor screens to identify compensatory pathways

  These approaches should incorporate time-course analyses to differentiate between primary and secondary effects, with particular attention to connections with G-protein signaling pathways known to regulate stress responses in G. zeae .

Data Analysis and Integration

• How can researchers integrate TIM50 functional data with broader mitochondrial proteomic datasets?

  Methodological approach for data integration includes:

  1. Multi-omics data integration frameworks:

     • Weighted correlation network analysis (WGCNA)

     • Bayesian network modeling

     • Principal component analysis for dimensionality reduction

  2. Functional enrichment and pathway analysis:

     • Gene Ontology enrichment

     • KEGG pathway mapping

     • Protein-protein interaction network analysis

  3. Comparative analysis across fungal species:

     • Ortholog mapping and functional conservation

     • Identification of species-specific adaptations

     • Evolutionary trajectory reconstruction

  Integration should focus on connecting TIM50 function to broader cellular processes, particularly the relationship between mitochondrial protein import and pathogenicity factors in G. zeae, such as mycotoxin production (DON and ZEA), which are known to be regulated by G-protein signaling .

• What bioinformatic approaches can identify potential regulatory elements affecting TIM50 expression in G. zeae?

  Comprehensive regulatory element analysis requires:

  1. Promoter analysis and transcription factor binding site prediction:

     • De novo motif discovery in upstream regions

     • Comparative genomics across Fusarium species

     • ChIP-seq data integration where available

  2. Epigenetic regulation assessment:

     • DNA methylation profiling

     • Histone modification mapping

     • Chromatin accessibility analysis

  3. Post-transcriptional regulation:

     • miRNA target site prediction

     • RNA-binding protein motif analysis

     • mRNA stability determinant identification

  Analysis should incorporate data from different developmental stages and environmental conditions to identify context-dependent regulatory mechanisms, particularly focusing on conditions that might trigger changes in mitochondrial function during host infection.

• How can contradictory experimental results regarding TIM50 function be reconciled through proper experimental design?

  Resolving contradictory results requires:

  1. Systematic sources of variation analysis:

     • Strain background differences (genetic modifiers)

     • Experimental condition variations

     • Methodological differences in assays

  2. Independent validation with orthogonal approaches:

     • Multiple techniques addressing the same question

     • Collaboration between laboratories

     • Standardized protocols with defined parameters

  3. Conceptual framework revision:

     • Re-examination of underlying assumptions

     • Development of more nuanced models

     • Consideration of context-dependency

  For example, apparent contradictions between TIM50's role in different fungi might be resolved by carefully examining species-specific adaptations in mitochondrial import machinery or differences in experimental systems used. The relationship between mitochondrial function and G-protein signaling pathways in toxin production might also explain seemingly contradictory phenotypes.

• What statistical approaches are most appropriate for analyzing TIM50 mutant phenotypes in G. zeae?

  Robust statistical analysis should include:

  1. Experimental design optimization:

     • Power analysis to determine sample sizes

     • Randomization and blocking strategies

     • Appropriate control selection

  2. Statistical modeling approaches:

     • Mixed-effects models for repeated measures

     • Multivariate analysis for complex phenotypes

     • Bayesian approaches for integrating prior knowledge

  3. Multiple testing correction strategies:

     • False discovery rate control

     • Family-wise error rate methods

     • Hierarchical testing procedures

  For phenotypic analysis of TIM50 mutants, particular attention should be paid to potential pleiotropic effects, as mitochondrial import defects can affect numerous cellular processes. Comparison with phenotypes from other mitochondrial import machinery mutants and G-protein signaling mutants can provide valuable context for interpretation.

• How can researchers develop a systems biology framework to understand TIM50's role in the broader context of G. zeae biology?

  A comprehensive systems biology approach requires:

  1. Multi-scale modeling integration:

     • Molecular dynamics simulations of protein interactions

     • Metabolic flux analysis

     • Whole-cell modeling incorporating mitochondrial processes

  2. Network-based analyses:

     • Protein-protein interaction networks

     • Metabolic network modeling

     • Regulatory network reconstruction

  3. Perturbation response profiling:

     • Systematic genetic modifications

     • Environmental stress responses

     • Chemical inhibitor studies

  This framework should specifically address how TIM50 function interfaces with known virulence mechanisms in G. zeae, including toxin production pathways and stress responses regulated by heterotrimeric G protein signaling . The relationship between mitochondrial function and fungal adaptation to host environments represents a particularly promising area for systems-level investigation.