Recombinant Gibberella zeae Mitochondrial inner membrane magnesium transporter mrs2 (MRS2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
MRS2; FGRRES_16995; FGSG_08660; Mitochondrial inner membrane magnesium transporter MRS2; RNA-splicing protein MRS2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
59-498
Protein Length
Full Length of Mature Protein
Species
Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)
Target Names
MRS2
Target Protein Sequence
FSTSRNAQGFWSGRKSSSSYMPTWNSFLKFAGKKNEKALKPDDLPNHDEFGDNSSIFNNR RTLAAKAASEPRLRCTEVDEHGNVILVDGEFKKTELIAKFGLLPRDLRKIDSSNLPHILI RPSAILLNLLHLKVLIKHDRVLLFDIYGSKTSYPQSAFMYDLQGKLQQKTAPGNASLPYE FRALEAVLTSVTSELEADFEAVREPVMHILSELEDDIDRHKLRMLLILSKRVSTFEQKAK LVRDAIEDLLEADDDLADMYLTEKTHDLYRGEDDHTEVEMLLESYHKLTDEIVQEAGNLV SGIRNTEEIVRAILDANRNALMLLDLKFSVGTLGLAMGTFLAGLYGMNLENFIEETNWGF AGVTGVSVVFSLIVCWYGLTKLRRVQRIKMMDAERPAIARGQSYFPDDRSALGLLDNRNR EMLRRINMQKAVSQQKKKWL
Uniprot No.

Target Background

Function

Recombinant Gibberella zeae Mitochondrial inner membrane magnesium transporter mrs2 (MRS2) functions as a high-conductance magnesium-selective channel, mediating magnesium influx into the mitochondrial matrix. It plays a crucial role in the splicing of mitochondrial group II introns by modulating mitochondrial magnesium concentrations, which are essential for this process. Furthermore, MRS2 suppresses various mitochondrial intron mutations, and its absence can disrupt the assembly of mitochondrial membrane complexes.

Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Gibberella zeae MRS2 and what is its role in fungal biology?

MRS2 (Mitochondrial inner membrane magnesium transporter mrs2) is a protein encoded by the MRS2 gene in Gibberella zeae (also known as Fusarium graminearum). It functions as a magnesium transporter located in the mitochondrial inner membrane. This protein plays a crucial role in magnesium homeostasis within the mitochondria, which is essential for various cellular processes including energy production, protein synthesis, and metabolic regulation .

The protein is also known by the alternative name "RNA-splicing protein MRS2," suggesting a dual function in RNA processing, potentially linking magnesium transport to gene expression regulation in this fungal pathogen . Understanding MRS2's function provides insights into both basic fungal biology and potential pathogenicity mechanisms.

How is recombinant Gibberella zeae MRS2 protein typically stored and handled?

Recombinant MRS2 protein requires specific storage and handling conditions to maintain stability and activity. The protein is typically supplied in a Tris-based buffer containing 50% glycerol, optimized specifically for this protein . For storage, the recommended conditions are:

  • Long-term storage: -20°C or -80°C for extended periods

  • Working storage: 4°C for up to one week

  • Aliquoting: Division into smaller volumes is recommended to avoid repeated freeze-thaw cycles

It is critical to avoid repeated freezing and thawing as this can lead to protein denaturation and loss of activity . When working with the protein, researchers should maintain a cold chain and handle samples on ice whenever possible to preserve structural integrity and functional activity.

How does MRS2 functionality relate to pathogenicity in Gibberella zeae?

While direct information linking MRS2 to pathogenicity is not explicitly stated in the search results, we can analyze its potential role based on understanding of fungal pathogenesis mechanisms. As a mitochondrial magnesium transporter, MRS2 likely influences energy production and cellular metabolism, which are critical for fungal growth, sporulation, and host invasion processes.

Gibberella zeae is known to produce ascospores in fruiting bodies (perithecia) that serve as primary inocula for Fusarium head blight disease . The proper development of these structures depends on coordinated cellular differentiation, which requires optimal mitochondrial function. Disruption of magnesium homeostasis through MRS2 dysfunction might therefore impact pathogenicity through several potential mechanisms:

  • Altered energy production affecting hyphal growth and penetration

  • Disrupted metabolic pathways involved in mycotoxin production

  • Impaired sporulation and reproductive capability

  • Compromised stress responses during host colonization

Research examining MRS2 knockouts or expression modulation would be valuable to determine its precise role in virulence, similar to studies of other genes in this pathogen such as MYT2, which has been shown to affect virulence when its expression is altered .

What experimental approaches are most effective for studying MRS2 function in Gibberella zeae?

To effectively study MRS2 function in Gibberella zeae, researchers should consider a multi-faceted approach:

  • Gene Deletion and Overexpression Studies: Creating knockout mutants (Δmrs2) and overexpression strains (MRS2OE) using techniques such as CRISPR-Cas9 or homologous recombination. This approach allows for phenotypic comparison with wild-type strains to assess changes in growth, development, and pathogenicity .

  • Protein Localization Studies: Using fluorescent protein tags (e.g., GFP fusion) to confirm mitochondrial localization and to examine potential changes in localization under different conditions or developmental stages, similar to approaches used for other proteins in G. zeae .

  • Magnesium Transport Assays: Developing assays to measure magnesium transport in isolated mitochondria from wild-type and mutant strains, potentially using fluorescent magnesium indicators or radioisotope techniques.

  • Transcriptional Analysis: Employing qRT-PCR to examine MRS2 expression patterns during different developmental stages and under various stress conditions. This can provide insights into when and where the protein functions most actively .

  • Pathogenicity Assays: Conducting wheat head infection studies with MRS2 mutant strains to assess changes in virulence, disease progression, and mycotoxin production .

These approaches should be complemented with appropriate controls as outlined in experimental design principles to ensure reliable and interpretable results.

How can researchers effectively analyze and interpret phenotypic changes in MRS2 mutants?

When analyzing phenotypic changes in MRS2 mutants, researchers should implement a systematic approach:

  • Comprehensive Phenotypic Characterization:

    • Vegetative growth rates and morphology

    • Perithecium development and ascospore production

    • Conidiation rates and conidial morphology

    • Stress responses (oxidative, osmotic, temperature)

    • Virulence in plant infection models

    • Mycotoxin production profiles

  • Quantitative Measurement Protocols:

    • For growth: Measure colony diameter at regular intervals under standardized conditions

    • For reproduction: Count perithecia, ascospores, and conidia using consistent sampling methods

    • For virulence: Use standard disease scoring systems on infected plant material

    • For mycotoxin analysis: Employ HPLC or LC-MS/MS for quantification

  • Statistical Analysis Framework:

    • Apply appropriate statistical tests (ANOVA, t-tests) with multiple comparisons correction

    • Use regression analysis for time-course experiments

    • Consider multiple biological and technical replicates (minimum n=3)

    • Report effect sizes along with p-values

  • Molecular Mechanism Investigation:

    • Correlate phenotypic changes with alterations in gene expression

    • Examine potential compensatory responses in related pathways

    • Consider indirect effects on other cellular processes

Similar analytical approaches have been effectively used to interpret phenotypic changes in other G. zeae mutants, such as those affecting the MYT2 transcription factor, where changes in perithecium size, growth, and virulence were systematically characterized and related to molecular mechanisms .

What are the best practices for designing experiments with recombinant MRS2 protein?

When designing experiments with recombinant MRS2 protein, researchers should follow these best practices:

  • Experimental Controls:

    • Positive controls: Include well-characterized magnesium transporters from related species

    • Negative controls: Use inactive protein variants or buffer-only conditions

    • Isogenic controls: Compare with wild-type protein when testing mutant variants

    • Vehicle controls: Account for effects of storage buffer components

  • Concentration Optimization:

    • Determine appropriate protein concentrations through preliminary dose-response experiments

    • Typical working concentrations range from 0.1-10 μg/mL depending on the specific assay

    • Ensure protein is within its linear response range for quantitative assays

  • Environmental Parameters:

    • Control temperature, pH, and ionic strength to maintain protein stability

    • Consider the natural mitochondrial environment when designing buffer systems

    • Account for potential metal ion interactions (especially other divalent cations)

  • Replication Strategy:

    • Minimum of three biological replicates per condition

    • Include technical replicates to account for measurement variation

    • Power analysis to determine appropriate sample sizes based on expected effect sizes

  • Quality Control Measures:

    • Verify protein integrity by SDS-PAGE before experiments

    • Confirm activity using functional assays when possible

    • Document batch information and storage conditions

These design considerations help ensure robust, reproducible results in experiments with recombinant MRS2 protein, minimizing variability and increasing confidence in observed effects.

How should researchers set up qRT-PCR experiments to study MRS2 expression?

For robust qRT-PCR analysis of MRS2 expression in Gibberella zeae, researchers should follow this methodological framework:

  • Sample Collection and RNA Extraction:

    • Collect fungal material from key developmental stages (vegetative growth, sexual development)

    • Sample at multiple time points (e.g., 3, 5, and 7 days post-induction) to capture expression dynamics

    • Extract total RNA using established fungal RNA isolation protocols with RNase-free conditions

    • Verify RNA quality using spectrophotometry (A260/A280 ratio) and gel electrophoresis

  • cDNA Synthesis:

    • Use high-quality reverse transcriptase (e.g., SuperScriptIII)

    • Include appropriate controls (no-RT controls to detect genomic DNA contamination)

    • Standardize input RNA amounts across all samples

    • Store cDNA at -20°C for short-term use

  • Primer Design and Validation:

    • Design MRS2-specific primers spanning exon-exon junctions when possible

    • Optimal amplicon size: 80-150 bp

    • Verify primer specificity through melt curve analysis and gel electrophoresis

    • Determine primer efficiency using standard curves (acceptable range: 90-110%)

  • Reference Gene Selection:

    • Use established reference genes for G. zeae such as cyclophilin (CyP1; FGSG_07439.3)

    • Validate reference gene stability across experimental conditions

    • Consider using multiple reference genes for more robust normalization

  • qPCR Reaction Setup:

    • Use SYBR Green Super mix or similar reagents

    • Perform reactions in triplicate with at least two biological replicates per condition

    • Include no-template controls in each run

    • Follow a standardized thermal cycling protocol

  • Data Analysis:

    • Calculate relative expression using the 2^-ΔΔCt method

    • Use the formula: 2^-ΔΔCt where ΔCt = Ct(MRS2) - Ct(reference gene) and ΔΔCt = ΔCt(sample) - ΔCt(calibrator)

    • Apply statistical analysis (e.g., Tukey's test) to determine significant differences (p<0.05)

    • Present data with appropriate error bars representing biological variation

This approach closely parallels successful qRT-PCR methodologies used for other G. zeae genes, such as MYT2, ensuring reliable quantification of MRS2 expression patterns .

What techniques are recommended for studying protein-protein interactions involving MRS2?

To investigate protein-protein interactions involving MRS2 in Gibberella zeae, researchers should consider these methodological approaches:

  • Co-Immunoprecipitation (Co-IP):

    • Generate antibodies against MRS2 or use epitope-tagged versions

    • Crosslink proteins in vivo before cell lysis to capture transient interactions

    • Use mitochondrial isolation procedures to enrich for relevant cellular compartment

    • Identify interacting partners through mass spectrometry analysis

    • Validate interactions through reciprocal Co-IP experiments

  • Yeast Two-Hybrid (Y2H) Screening:

    • Create bait constructs with MRS2 or specific domains

    • Screen against G. zeae cDNA library or candidate interactors

    • Validate positive interactions using growth assays on selective media

    • Confirm through secondary assays to eliminate false positives

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse MRS2 and potential interactors to complementary fragments of fluorescent proteins

    • Express in G. zeae or heterologous systems

    • Visualize interactions through fluorescence microscopy

    • Quantify signal intensity to assess interaction strength

  • Proximity-Dependent Biotin Identification (BioID):

    • Fuse MRS2 to a biotin ligase (BirA*)

    • Express in G. zeae and allow biotinylation of proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

    • Particularly useful for membrane proteins like MRS2

  • In vitro Binding Assays:

    • Express and purify recombinant MRS2 and potential partners

    • Perform pull-down assays using purified components

    • Measure binding affinity through surface plasmon resonance (SPR)

    • Use microscale thermophoresis (MST) for quantitative interaction analysis

When analyzing results, researchers should pay particular attention to interactions that occur in the mitochondrial environment and consider the effects of magnesium concentration on observed interactions, as this may regulate MRS2's interaction network.

How should researchers analyze the impact of MRS2 on fungal virulence and growth?

To comprehensively analyze the impact of MRS2 on fungal virulence and growth in Gibberella zeae, researchers should implement this analytical framework:

  • Growth Analysis Protocol:

    • Measure radial growth rates on solid media under different conditions

    • Quantify biomass in liquid culture through dry weight measurements

    • Assess hyphal morphology using microscopy and image analysis software

    • Compare growth parameters between wild-type, mrs2 deletion, and MRS2 overexpression strains

    • Create growth curves by measuring at regular intervals (e.g., every 12-24 hours)

  • Virulence Assessment Methodology:

    • Conduct wheat head infection assays using standardized inoculation procedures

    • Score disease progression using established scales at multiple time points

    • Quantify fungal biomass in infected tissue using qPCR

    • Measure mycotoxin accumulation using analytical chemistry techniques

    • Document spread of infection through visual and molecular methods

  • Data Analysis Approach:

    • Apply two-way ANOVA to assess strain and environmental condition interactions

    • Use repeated measures analysis for time-course experiments

    • Implement linear mixed-effects models to account for batch and environmental variations

    • Calculate area under the disease progress curve (AUDPC) for virulence comparisons

    • Perform correlation analysis between growth parameters and virulence metrics

  • Interpretation Framework:

    • Distinguish direct effects from indirect consequences of MRS2 modification

    • Consider pleiotropic effects and potential compensatory mechanisms

    • Correlate phenotypic changes with alterations in gene expression

    • Compare results with studies of other mitochondrial proteins or magnesium transporters

    • Evaluate consistency across multiple experimental conditions and plant hosts

This analytical approach is similar to methods used to assess the impact of MYT2 on G. zeae virulence, where modifications in gene expression resulted in altered growth characteristics and pathogenicity . Researchers should note that changes in growth do not always correlate directly with virulence, as demonstrated by the MYT2 deletion mutant which showed increased radial growth but reduced virulence .

What statistical methods are appropriate for analyzing differential expression of MRS2 across developmental stages?

For analyzing differential expression of MRS2 across developmental stages in Gibberella zeae, researchers should employ these statistical approaches:

  • Statistical Analysis Workflow:

    Analysis StageRecommended MethodsKey Considerations
    Data NormalizationReference gene normalization; Quantile normalizationSelect stable reference genes across all conditions
    Hypothesis TestingRepeated measures ANOVA; Linear mixed-effects modelsAccount for time-dependent correlation
    Multiple ComparisonsTukey's HSD; Benjamini-Hochberg correctionControl family-wise error rate
    Effect Size EstimationCohen's d; Log2 fold changeReport magnitude of differences
    Trend AnalysisPolynomial contrasts; Time-series modelingIdentify expression patterns over time
  • Sample Size Considerations:

    • Minimum of 3 biological replicates per developmental stage

    • Power analysis based on preliminary data or similar genes

    • Increased replication for stages with expected high variability

  • Visualization Methods:

    • Line graphs showing expression trends across developmental stages

    • Box plots displaying variation within each stage

    • Heat maps for comparing MRS2 with related genes

    • Include error bars representing standard error or 95% confidence intervals

  • Advanced Statistical Approaches:

    • Consider time-series analysis methods for sequential sampling

    • Use Bayesian hierarchical models to incorporate prior knowledge

    • Implement ANCOVA when covariates like growth rate need to be controlled

    • Apply non-parametric methods when normality assumptions are violated

When interpreting results, researchers should consider the biological context of each developmental stage, particularly how mitochondrial function and magnesium requirements might vary throughout the fungal life cycle. This approach parallels successful methods used to analyze stage-specific expression of MYT2, where significant differences were detected between vegetative growth and sexual development phases .

How can researchers effectively characterize structural and functional domains of MRS2?

To characterize structural and functional domains of Gibberella zeae MRS2, researchers should implement a multi-level analysis strategy:

  • Sequence-Based Analysis:

    • Perform multiple sequence alignment with MRS2 proteins from diverse species

    • Identify conserved motifs characteristic of magnesium transporters

    • Use predictive algorithms to identify transmembrane domains, signal sequences, and functional motifs

    • Apply hydropathy analysis to map membrane-spanning regions

    • Identify potential regulatory sites such as phosphorylation or other post-translational modification sites

  • Structure Prediction Methods:

    • Generate 3D structure predictions using homology modeling

    • Apply ab initio modeling for unique domains

    • Validate structural models through molecular dynamics simulations

    • Predict magnesium binding sites using metal-binding site prediction algorithms

    • Cross-validate with experimental structures of related transporters when available

  • Functional Domain Mapping:

    • Create truncation series to identify minimal functional units

    • Perform site-directed mutagenesis of conserved residues

    • Generate chimeric proteins with domains from related transporters

    • Assess function through complementation assays in yeast mrs2 mutants

    • Measure transport activity of variants using in vitro reconstitution systems

  • Data Integration Approach:

    • Correlate sequence conservation with functional importance

    • Map evolutionary pressure (dN/dS ratios) onto structural models

    • Integrate data from multiple experimental approaches into unified domain maps

    • Compare with known structural features of other mitochondrial transporters

    • Develop testable hypotheses about structure-function relationships

This comprehensive approach enables researchers to develop a detailed understanding of how MRS2's structure relates to its function as a mitochondrial magnesium transporter, providing insights into both basic biology and potential targets for antifungal development.

How does G. zeae MRS2 compare to homologous proteins in other fungal species?

Comparative analysis of G. zeae MRS2 with homologous proteins across fungal species reveals important evolutionary and functional insights:

  • Sequence Conservation Patterns:

    • The core magnesium transport domain shows high conservation across ascomycetes

    • N-terminal targeting sequences exhibit greater variability, reflecting species-specific mitochondrial import mechanisms

    • Key magnesium-binding motifs (typically GMN motifs) are highly conserved across fungal species

    • Regulatory domains show lineage-specific adaptations potentially related to different ecological niches

  • Phylogenetic Relationships:

    • G. zeae MRS2 clusters most closely with other Fusarium species transporters

    • Clear separation between plant pathogenic and saprophytic fungal MRS2 clades

    • Evidence of functional divergence in specific lineages based on selection pressure analysis

    • Conservation patterns suggest core transport function predates fungal diversification

  • Functional Comparison Table:

    SpeciesMRS2 FunctionKey Structural DifferencesPhenotypes in Mutants
    G. zeaeMg²⁺ transport; Potential RNA splicingFull-length protein (440 aa)Not fully characterized
    S. cerevisiaeMg²⁺ transport; Essential for growth on non-fermentable carbonExtended N-terminusRespiratory deficiency
    N. crassaMg²⁺ homeostasis; Circadian rhythm regulationAdditional regulatory domainAltered growth rhythms
    M. oryzaeMg²⁺ transport; Stress responseModified transmembrane domainsReduced pathogenicity
    A. fumigatusMg²⁺ homeostasis; Virulence factorUnique C-terminal extensionAttenuated virulence
  • Evolutionary Implications:

    • Evidence suggests G. zeae MRS2 may have acquired specialized functions related to plant pathogenesis

    • Conservation of dual RNA processing and transport functions across some but not all fungal lineages

    • Selective pressure analysis indicates adaptation to different cellular magnesium requirements

This comparative approach not only contextualizes G. zeae MRS2 within fungal evolution but also highlights potential species-specific adaptations that may relate to pathogenicity and ecological specialization.

What model systems can best be used to study MRS2 function in heterologous expression systems?

Researchers investigating G. zeae MRS2 should consider these model systems for heterologous expression studies:

  • Saccharomyces cerevisiae Expression System:

    • Advantages: Well-characterized mrs2Δ mutants available; Similar mitochondrial architecture; Genetic manipulation tools well-established; Growth phenotypes easily quantified

    • Methodology: Express G. zeae MRS2 in S. cerevisiae mrs2Δ background; Assess complementation of respiratory growth defects; Measure mitochondrial magnesium levels; Analyze effects on mitochondrial function

    • Controls: Include wild-type yeast MRS2, empty vector, and G. zeae MRS2 mutant variants

    • Analysis: Growth curves on fermentable vs. non-fermentable carbon sources; Mitochondrial isolation and functional assays

  • Bacterial Expression Systems:

    • Advantages: High protein yield; Simplified purification; Suitable for structural studies

    • Methodology: Express in E. coli strains optimized for membrane proteins; Use solubilization tags if needed; Reconstitute in liposomes for transport assays

    • Controls: Include known magnesium transporters; Empty liposomes; Transport-deficient mutants

    • Analysis: In vitro transport assays using fluorescent magnesium indicators or isotope uptake

  • Mammalian Cell Lines:

    • Advantages: Complex eukaryotic cellular environment; Advanced microscopy capabilities; Relevant for studying interactions with host systems

    • Methodology: Express tagged G. zeae MRS2 in appropriate cell lines; Target to mitochondria using native or artificial targeting sequences; Assess localization and function

    • Controls: Include cells expressing mammalian MRS2 homologs and transport-deficient mutants

    • Analysis: Live-cell imaging; Magnesium flux measurements; Mitochondrial function assays

  • Selection of Optimal System Based on Research Questions:

    Research ObjectiveRecommended SystemKey Advantage
    Basic transport mechanismBacterial + liposomesDefined system for kinetic studies
    Structural studiesE. coli or insect cellsHigh protein yield for crystallography
    In vivo functionS. cerevisiaeWell-characterized mrs2Δ phenotypes
    Protein-protein interactionsYeast or mammalian cellsNatural cellular environment
    Regulatory mechanismsS. cerevisiaeGenetic tools for pathway analysis

Each system offers distinct advantages, and researchers should select based on their specific research questions, available resources, and required downstream applications for studying G. zeae MRS2.

What are the key considerations for designing a comprehensive research program on G. zeae MRS2?

Researchers developing a comprehensive research program on Gibberella zeae MRS2 should consider these integrated approaches:

  • Multi-level Experimental Strategy:

    • Molecular characterization: Gene structure, expression patterns, and regulation mechanisms

    • Protein analysis: Structure determination, post-translational modifications, and interaction networks

    • Cellular studies: Subcellular localization, trafficking, and context-dependent functions

    • Organismal investigations: Phenotypic effects on growth, development, and pathogenicity

    • Comparative analyses: Evolutionary conservation and species-specific adaptations

  • Technology Integration Plan:

    • Combine genetic approaches (CRISPR-Cas9, RNAi) with biochemical methods

    • Integrate structural studies with functional assays

    • Employ both in vitro and in vivo experimental systems

    • Utilize advanced imaging techniques alongside molecular analyses

    • Implement computational modeling to guide experimental design

  • Research Team Composition:

    • Molecular biologists for gene manipulation and expression studies

    • Protein biochemists for structural and functional characterization

    • Cell biologists for localization and interaction studies

    • Plant pathologists for virulence and host-pathogen interaction analysis

    • Bioinformaticians for comparative genomics and structural predictions

  • Translational Applications Focus:

    • Explore MRS2 as a potential antifungal target

    • Investigate implications for crop protection strategies

    • Consider broader applications to understanding mitochondrial transport biology

    • Develop tools and resources of value to the wider fungal research community

By implementing this comprehensive approach, researchers can develop a thorough understanding of G. zeae MRS2's structure, function, and biological significance, while generating knowledge applicable to both fundamental science and applied agricultural research aimed at controlling this important plant pathogen.

What are the most significant unanswered questions about G. zeae MRS2 that warrant future research?

Several critical knowledge gaps regarding G. zeae MRS2 deserve focused research attention:

  • Functional Significance Questions:

    • How does MRS2 activity influence mitochondrial function during different developmental stages?

    • What is the precise contribution of MRS2 to virulence and pathogenicity in wheat and other hosts?

    • Does MRS2 play a role in mycotoxin production regulation similar to other mitochondrial proteins?

    • What is the relationship between its magnesium transport function and potential RNA processing role?

    • How does MRS2 activity respond to host defense mechanisms during infection?

  • Regulatory Mechanism Inquiries:

    • What transcription factors control MRS2 expression during development and stress?

    • How is MRS2 activity post-translationally regulated in response to cellular magnesium levels?

    • What signaling pathways modulate MRS2 function during host colonization?

    • Is MRS2 expression or function affected by plant-derived compounds?

    • Does mitochondrial membrane potential affect MRS2 transport activity?

  • Structural Biology Investigations:

    • What are the key structural determinants of magnesium selectivity in G. zeae MRS2?

    • How does the protein's structure change during transport cycles?

    • Which domains are essential for function versus regulatory modulation?

    • Are there structural features unique to pathogenic fungi that could be targeted?

    • How do potential interacting proteins affect MRS2 conformation and function?

  • Evolutionary and Comparative Aspects:

    • How has MRS2 evolved among different Fusarium species with varying host ranges?

    • Are there functional differences between MRS2 in pathogenic versus non-pathogenic fungi?

    • What can be learned from comparing MRS2 across fungal, plant, and animal kingdoms?

    • Has MRS2 undergone adaptive evolution related to fungal pathogenicity?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.