Recombinant Gibberella zeae Palmitoyltransferase PFA3 (PFA3)

Shipped with Ice Packs
In Stock

Description

Introduction to Palmitoyltransferase PFA3

Palmitoyltransferase PFA3 is an enzyme derived from Gibberella zeae (anamorph: Fusarium graminearum), a destructive fungal pathogen that causes Fusarium head blight (FHB) on wheat, barley, and other cereal crops worldwide . This homothallic ascomycete fungus is responsible for billions of dollars in agricultural losses annually and produces harmful mycotoxins, including deoxynivalenol (DON) and zearalenone, which pose significant threats to human and animal health .

Within the cellular machinery of G. zeae, palmitoyltransferases play crucial roles in protein lipidation, specifically catalyzing the addition of palmitate to specific cysteine residues in target proteins through S-acylation (also known as palmitoylation). This post-translational modification is essential for regulating protein localization, stability, and function in various cellular processes .

Protein Structure and Domains

Recombinant PFA3 from Gibberella zeae is a full-length protein consisting of 550 amino acids . Sequence analysis reveals characteristic domains common to the DHHC-CRD (Asp-His-His-Cys cysteine-rich domain) family of palmitoyltransferases, including transmembrane domains and a conserved DHHC motif essential for catalytic activity .

Key Protein Parameters

Table 1: Basic Properties of Recombinant G. zeae PFA3

ParameterSpecification
UniProt IDQ4IA62
Gene NamePFA3
ORF NamesFG05896, FGSG_05896, FGRRES_05896
OrganismGibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084)
Protein Length550 amino acids
Molecular FunctionPalmitoyltransferase (EC 2.3.1.-)
Alternative NamesProtein fatty acyltransferase 3

Expression Systems

For research and analytical purposes, G. zeae PFA3 is typically expressed as a recombinant protein in Escherichia coli expression systems . The recombinant version is commonly fused to an N-terminal histidine (His) tag to facilitate purification using affinity chromatography . This approach enables the production of sufficient quantities of the protein for structural and functional studies.

Purification and Formulation

Following expression in E. coli, the His-tagged recombinant PFA3 protein is purified through a series of chromatographic steps to achieve high purity (typically >90% as determined by SDS-PAGE) . The purified protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain protein stability during storage .

Enzymatic Activity

As a palmitoyltransferase, PFA3 catalyzes the transfer of palmitate (a 16-carbon saturated fatty acid) from palmitoyl-CoA to cysteine residues in target proteins. This S-acylation is a reversible post-translational modification that regulates various aspects of protein function and cellular processes .

Role in Fungal Biology

While the specific functions of PFA3 in G. zeae have not been extensively characterized, studies on related palmitoyltransferases in fungi suggest potential roles in:

  1. Regulation of G protein-mediated signaling pathways, which control various aspects of fungal growth, development, and virulence

  2. Modification of proteins involved in sexual reproduction and development

  3. Potential involvement in pathogenicity and mycotoxin production mechanisms

Comparison with Related Palmitoyltransferases

G. zeae possesses multiple palmitoyltransferases, including PFA3 and PFA4, which likely have distinct but potentially overlapping functions.

Table 2: Comparison of G. zeae Palmitoyltransferases

FeaturePFA3PFA4
UniProt IDQ4IA62Q4IMZ7
Length550 amino acids437 amino acids
ORF NamesFGSG_05896FGSG_01411
DHHC MotifPresentPresent
Expression in E. coliSuccessful with N-terminal His tagSuccessful with N-terminal His tag
Cellular RolePutative roles in signaling and developmentPutative roles in signaling and development

Drug Discovery and Agricultural Applications

Understanding the structure and function of PFA3 may contribute to the development of antifungal agents targeting protein palmitoylation in G. zeae and related pathogenic fungi. Given the economic importance of Fusarium head blight, such research has potential applications in agriculture for developing strategies to control fungal infections and reduce mycotoxin contamination in cereal crops .

Genetic and Molecular Studies

Recombinant PFA3 can be used in gene disruption and complementation studies to investigate its role in G. zeae development, pathogenicity, and mycotoxin production. RNA-seq analysis has been employed to study expression patterns of various G. zeae genes, including those potentially regulated by or interacting with PFA3 .

Reconstitution Protocol

For optimal results when working with recombinant G. zeae PFA3, the following reconstitution protocol is recommended:

  1. Briefly centrifuge the vial prior to opening to bring contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (with 50% being commonly used) for long-term storage

  4. Aliquot the reconstituted protein to minimize freeze-thaw cycles

Ongoing Research

Current research on G. zeae and its proteins, including PFA3, focuses on several key areas:

  1. Functional analysis of heterotrimeric G protein subunits and their regulators in G. zeae, which may interact with or be regulated by palmitoylation via enzymes like PFA3

  2. Investigation of lipase activity and regulation mechanisms in G. zeae, providing insights into lipid metabolism pathways that may intersect with protein palmitoylation

  3. Studies on sexual development and mycotoxin production, processes that may involve proteins modified by palmitoyltransferases

Future Research Directions

Future studies on G. zeae PFA3 may explore:

  1. Identification of specific protein substrates modified by PFA3 in G. zeae

  2. Determination of the three-dimensional structure of PFA3 to better understand its catalytic mechanism

  3. Development of specific inhibitors targeting PFA3 or related palmitoyltransferases as potential antifungal agents

  4. Investigation of the role of PFA3 in stress response and adaptation of G. zeae to various environmental conditions

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify it in your order remarks, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize developing it accordingly.
Synonyms
PFA3; FGRRES_05896; FGSG_05896; Palmitoyltransferase PFA3; Protein fatty acyltransferase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-550
Protein Length
full length protein
Species
Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)
Target Names
PFA3
Target Protein Sequence
MASARRWARKAERCCCTFATYFPLAFVYGLTSWAVWVVVNIGSVSTKSSWIGTGSSIVGV ALYVMLNWCYTTAVFTPPGSTTNDMGYGLLPTQNTPQATSFTVKSNGEFRFCKKCQARKP DRAHHCSTCRRCVLKMDHHCPWLATCIGLRNHKAFLLFLIYTSLFCFWSFAVSACWVWYE ALNDQEYIDSFLPVNFIMLSVISGIIGLVVGAFTSWHIHLARCGQTTIECLEKTRYLSPL RKTYNSAHNPANEVPEAARHFVDFHANALPGITRPEEGEERREMPRSYPPDGSQPVQLSY AQREREQRQRRYEEYLDEQDSEKLPNVFDLGWKRNLLHLFGPTPALWFFPVSNTTGDGWT WEASSTWLEARDRLSAEREQQRAREVNAGWGSPDDIPDIPERPTGAGKHYSPSPNLAGPK TMSKADRVLGRDPNLYADATQDVPMQRLSPRGRSIDDELADLDTDDEDGFLDANNPDKAE GGKFSPSFTSDSHRRDDAEARALEVVTNGNWGRGGASGMLRKGSSQSTPTRTPSNLSRSG TPKFQDEGVD
Uniprot No.

Target Background

Function
Palmitoyltransferase specific for VAC8. Catalyzes the palmitoylation of VAC8 at one or more of its N-terminal cysteine residues. This modification is essential for proper membrane localization of VAC8.
Database Links
Protein Families
DHHC palmitoyltransferase family, PFA3 subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is Gibberella zeae Palmitoyltransferase PFA3 and what is its biological function?

Palmitoyltransferase PFA3 (PFA3) is an enzyme produced by Gibberella zeae (also known as Fusarium graminearum), a significant fungal pathogen that causes Fusarium Head Blight in cereal crops. The enzyme belongs to the family of palmitoyltransferases (EC 2.3.1.-) that catalyze the transfer of palmitoyl groups to substrates . These enzymes are involved in protein fatty acylation, which is an important post-translational modification that can affect protein localization, stability, and function.

In Gibberella zeae, PFA3 likely plays roles in fungal growth, development, and potentially in pathogenicity, although its specific biological functions are still being characterized. The importance of studying this enzyme stems from the pathogenic nature of Gibberella zeae, which not only causes significant crop yield losses but also produces mycotoxins like deoxynivalenol (DON) and zearalenone (ZEA) that threaten human and animal health .

What expression systems are suitable for recombinant PFA3 production?

Based on available research, E. coli has been successfully used as an expression system for recombinant PFA3 production . When expressing fungal proteins like PFA3 in E. coli, researchers should consider the following factors:

  • Strain selection: E. coli SHuffle T7 strain has been reported to be effective for fungal protein expression, as it may help with proper disulfide bond formation for proteins that contain multiple cysteine residues .

  • Vector design: Selection of an appropriate expression vector is crucial. For fungal proteins that tend to form inclusion bodies, optimization of vectors may be necessary. The pFL-B62cl vector has been used successfully for expression of some Gibberella zeae proteins .

  • Expression conditions: Optimizing temperature, inducer concentration, and induction time is essential. Lower temperatures (15-25°C) often lead to better soluble expression of fungal proteins.

  • Purification strategy: For PFA3, a His-tag purification approach using Ni-NTA affinity chromatography followed by size exclusion (Sephadex G-25) and ion exchange (DEAE) has been demonstrated to be effective for obtaining electrophoretic purity .

What experimental design approaches are recommended for optimizing recombinant PFA3 expression?

Design of Experiments (DoE) approaches are highly recommended for optimizing recombinant protein expression, including PFA3, as they allow for the systematic evaluation of multiple factors simultaneously . A factorial design strategy is particularly useful because it can determine not only the significant individual factors but also their interactions .

A recommended experimental design workflow includes:

  • Screening phase: Use a fractional factorial design to identify significant factors among multiple variables (e.g., temperature, inducer concentration, media composition, induction time). This allows efficient screening with fewer experiments .

  • Optimization phase: Once significant factors are identified, use response surface methodology (RSM) to find optimal conditions. Central composite design (CCD) or Box-Behnken design are commonly used in this phase .

  • Validation: Confirm the model predictions by running experiments at the predicted optimal conditions.

Table 1: Example of a 2³ factorial design for PFA3 expression optimization

ExperimentTemperature (°C)IPTG (mM)Post-induction time (h)Soluble PFA3 yield (mg/L)
1180.1480
2280.1465
3181.04100
4281.0450
5180.116120
6280.11690
7181.016250
8281.01670

This approach has been shown to effectively optimize expression conditions, achieving up to 250 mg/L of soluble recombinant protein with appropriate functional characteristics .

How can researchers assess the functional activity of recombinant PFA3?

Assessing the functional activity of recombinant PFA3 would require appropriate enzymatic assays based on its palmitoyltransferase activity. While specific assays for PFA3 are not detailed in the provided search results, similar approaches to those used for other lipid-modifying enzymes from Gibberella zeae can be adapted:

  • Substrate specificity assay: Using either the classical emulsified system or monomolecular film technique to test the enzyme's activity against various substrates. For palmitoyltransferases, this would involve monitoring the transfer of palmitoyl groups to suitable acceptor molecules .

  • Kinetic analysis: Determining enzymatic parameters (Km, Vmax, kcat) using varying concentrations of palmitoyl-CoA and acceptor substrates.

  • Functional complementation: Testing whether the recombinant PFA3 can restore function in mutant strains lacking this enzyme, which would provide evidence for its biological role.

  • Molecular docking studies: Computational approaches to predict substrate binding and enzyme-substrate interactions can complement experimental activity assays, as demonstrated for other Gibberella zeae enzymes .

To ensure reliability, activity measurements should be performed under optimized conditions (pH, temperature, buffer composition) and with appropriate controls.

What purification strategies yield the highest purity and activity for recombinant PFA3?

Based on successful purification strategies used for other recombinant proteins from Gibberella zeae, a multi-step purification approach is recommended for PFA3 :

  • Initial capture: Ni-NTA affinity chromatography is suitable for His-tagged PFA3, using imidazole gradients for elution (typically 20-250 mM).

  • Intermediate purification: Size exclusion chromatography using Sephadex G-25 can effectively remove imidazole and salts while providing additional separation based on molecular size.

  • Polishing: Ion exchange chromatography using DEAE can further enhance purity by separating proteins based on charge differences.

Typical purification results may yield approximately 90 mg of purified protein per liter of culture with electrophoretic purity as demonstrated by a single band on SDS-PAGE .

To maintain enzyme activity during purification:

  • Perform all steps at 4°C when possible

  • Include stabilizing agents (e.g., glycerol at 6-50%) in storage buffers

  • Use buffers with optimal pH (typically Tris/PBS-based, pH 8.0 for PFA3)

  • Avoid repeated freeze-thaw cycles by storing working aliquots at 4°C for short-term use and at -20°C/-80°C for long-term storage

How can genetic manipulation of PFA3 in Gibberella zeae provide insights into fungal pathogenesis?

Genetic manipulation of PFA3 in Gibberella zeae can provide valuable insights into the role of this enzyme in fungal pathogenesis through several methodological approaches:

  • Gene deletion studies: Creating a PFA3 knockout strain using homologous recombination or CRISPR-Cas9 technology would allow researchers to assess its role in fungal growth, development, and pathogenicity. Similar studies with other G. zeae genes have revealed their impact on vegetative growth, sexual development, toxin production, and virulence .

  • Complementation experiments: Reintroduction of the PFA3 gene into deletion mutants can confirm whether observed phenotypic changes are specifically due to the absence of PFA3 rather than unintended genetic alterations.

  • Domain analysis through targeted mutagenesis: Site-directed mutagenesis of key functional domains can reveal which parts of PFA3 are essential for its activity and pathogenicity-related functions.

  • Gene expression analysis: Quantitative PCR or RNA-seq analysis can reveal how PFA3 expression changes during different stages of infection and under different environmental conditions, similar to comprehensive expression analyses conducted for polyketide synthase genes in G. zeae .

  • Protein localization studies: Tagging PFA3 with fluorescent proteins can reveal its subcellular localization during infection, providing clues about its functional role.

Research with other G. zeae genes has shown that even single gene modifications can significantly alter pathogenicity. For example, studies with G protein subunit genes demonstrated that deletion of GzGPA2 caused reduced pathogenicity, while deletion of other G protein genes affected sexual reproduction and toxin production .

What computational approaches can be used to predict substrate specificity of PFA3?

Advanced computational approaches can be valuable for predicting the substrate specificity of PFA3:

  • Homology modeling: Creating a 3D structural model of PFA3 based on crystal structures of related palmitoyltransferases can provide insights into its active site architecture.

  • Molecular docking simulations: Docking potential substrates into the active site can predict binding affinities and orientations. These predictions can then guide experimental validation of substrate preferences, as demonstrated for other enzymes from Gibberella zeae .

  • Molecular dynamics simulations: Simulating the dynamics of enzyme-substrate interactions over time can reveal conformational changes and binding stability.

  • Structure-based sequence analysis: Comparing the active site residues of PFA3 with those of characterized palmitoyltransferases can help identify determinants of substrate specificity.

  • Machine learning approaches: Training algorithms on known palmitoyltransferase-substrate pairs can help predict novel substrates for PFA3.

The computational predictions should be validated experimentally, as was done for Gibberella zeae lipase, where molecular docking results were found to be in concordance with in vitro tests, confirming substrate preferences and stereoselectivity .

How can researchers design experiments to investigate the relationship between PFA3 and mycotoxin production in Gibberella zeae?

Investigating the relationship between PFA3 and mycotoxin production requires a systematic experimental approach:

  • Genetic analysis using PFA3 mutants:

    • Generate PFA3 deletion, overexpression, and site-directed mutant strains

    • Analyze mycotoxin production in these mutants compared to wild-type strains

    • Measure levels of key mycotoxins like deoxynivalenol (DON) and zearalenone (ZEA) using gas chromatography-mass spectrometry (GC-MS)

  • Transcriptional analysis:

    • Examine co-expression patterns between PFA3 and known mycotoxin biosynthesis genes under various conditions

    • Use quantitative PCR or RNA-seq to measure expression levels

    • Compare expression profiles across different growth stages and environmental conditions

  • Experimental design for condition testing:

    • Implement factorial designs to test multiple factors simultaneously (e.g., temperature, pH, nutrient availability)

    • Use response surface methodology to identify optimal conditions for examining the PFA3-mycotoxin relationship

    • Apply blocked designs to control for experimental variables such as fungal strain differences

Table 2: Example of a randomized complete block design for examining PFA3 expression and mycotoxin production

Block (Strain)Treatment 1 (Control)Treatment 2 (Nitrogen limitation)Treatment 3 (pH stress)Treatment 4 (Temperature stress)
Wild-typePFA3: x₁, DON: y₁PFA3: x₂, DON: y₂PFA3: x₃, DON: y₃PFA3: x₄, DON: y₄
ΔPFA3PFA3: 0, DON: y₅PFA3: 0, DON: y₆PFA3: 0, DON: y₇PFA3: 0, DON: y₈
PFA3-OEPFA3: x₉, DON: y₉PFA3: x₁₀, DON: y₁₀PFA3: x₁₁, DON: y₁₁PFA3: x₁₂, DON: y₁₂

Previous studies with other Gibberella zeae genes have shown that G protein signaling components can regulate mycotoxin production. For instance, deletion of GzGPA1 and GzGPB1 enhanced DON and ZEA production, suggesting that these G protein subunits negatively control mycotoxin production . Similar methodologies could reveal whether PFA3 plays a direct or indirect role in mycotoxin biosynthesis pathways.

What are the common challenges in obtaining soluble recombinant PFA3 and how can they be addressed?

Common challenges in obtaining soluble recombinant PFA3 and their solutions include:

  • Inclusion body formation:

    • Problem: When expressed in E. coli, many fungal proteins form inclusion bodies

    • Solution: Optimize expression vector and strain selection. The combination of pFL-B62cl vector and E. coli SHuffle T7 strain has been successful for other Gibberella zeae proteins

    • Alternative approach: Use lower induction temperatures (15-20°C) and reduced inducer concentrations to slow protein synthesis and promote proper folding

  • Protein degradation:

    • Problem: Proteolytic degradation during expression or purification

    • Solution: Add protease inhibitors during cell lysis and purification

    • Alternative approach: Use E. coli strains deficient in specific proteases

  • Low yield:

    • Problem: Insufficient amounts of soluble protein

    • Solution: Apply DoE approaches to systematically optimize expression conditions

    • Demonstrated improvement: Optimization through factorial design has achieved up to 250 mg/L of soluble recombinant protein

  • Loss of activity during purification:

    • Problem: Protein inactivation during purification steps

    • Solution: Include stabilizing agents such as glycerol (6-50%) in buffers

    • Storage recommendation: Store at -20°C/-80°C for extended periods, with working aliquots at 4°C for up to one week

  • Poor reproducibility:

    • Problem: Variation in expression results between batches

    • Solution: Standardize protocols through statistical experimental design

    • Analysis method: Use ANOVA to identify significant factors affecting expression variability

How can researchers analyze and interpret substrate specificity data for PFA3?

Analyzing substrate specificity data for enzymes like PFA3 requires appropriate statistical and biochemical interpretation approaches:

  • Kinetic parameter comparison:

    • Calculate key kinetic parameters (Km, Vmax, kcat, kcat/Km) for each substrate

    • Analyze relative catalytic efficiency (kcat/Km) to rank substrate preference

    • Example: For Gibberella zeae lipase (rGZEL), substrate preference was determined by comparing activity ratios (e.g., glycolipid hydrolytic activity ratio of 0.06 vs. phospholipase activity ratio of 0.02)

  • Statistical analysis of substrate preference:

    • Use ANOVA to determine significant differences in activity across substrates

    • Apply post-hoc tests (e.g., Tukey's HSD) to identify statistically significant differences between specific substrates

    • Create preference order rankings based on statistical significance

  • Structure-activity relationship analysis:

    • Correlate structural features of substrates with enzymatic activity

    • Identify key structural determinants of substrate recognition

    • For palmitoyltransferases, analyze how variations in the acyl chain length and acceptor molecule affect activity

  • Data visualization:

    • Plot activity profiles across different substrates

    • Use heat maps to visualize activity patterns across multiple substrate variants

    • Create comparative bar charts with error bars to show relative activities and statistical significance

  • Integration with computational predictions:

    • Compare experimental substrate preference with computational docking scores

    • Validate or refine computational models based on experimental data

    • Use the refined model to predict activity on untested substrates

What statistical approaches are most appropriate for analyzing experimental data in PFA3 research?

The choice of statistical approaches depends on the experimental design and research questions:

  • For factorial experiments to optimize expression conditions:

    • ANOVA to identify significant main effects and interactions

    • Regression analysis to model the relationship between factors and response variables

    • Response surface methodology to identify optimal conditions

    • Example: In a 2³ factorial design for protein expression, ANOVA can identify which factors (temperature, inducer concentration, induction time) significantly affect PFA3 yield

  • For substrate specificity studies:

    • Paired t-tests for comparing activity between two substrates

    • Repeated measures ANOVA for comparing multiple substrates tested with the same enzyme preparation

    • Non-linear regression for fitting enzyme kinetic models

  • For blocked designs:

    • Randomized complete block ANOVA to account for block effects

    • Split-plot analysis for hierarchical experimental designs

    • Example: When testing PFA3 expression across different strains (blocks) and under different conditions (treatments), this approach can separate strain effects from treatment effects

  • For gene expression studies:

    • Normalization methods appropriate for qPCR or RNA-seq data

    • Differential expression analysis to identify conditions affecting PFA3 expression

    • Clustering methods to identify co-expressed genes

  • For analysis of confounded effects:

    • Partial confounding designs to allow estimation of all main effects

    • Analysis of variance techniques adapted for confounded factorial designs

    • Example: In cases where full factorial designs are impractical, confounding allows testing of higher-order interactions while maintaining ability to estimate main effects

Table 3: Statistical methods for different experimental approaches in PFA3 research

Experimental GoalRecommended DesignStatistical AnalysisKey Outputs
Expression optimizationFactorial designANOVA, regression analysisSignificant factors, optimal conditions
Substrate specificityRandomized complete blockRepeated measures ANOVAPreference ranking, significant differences
Gene expressionTime series or condition seriesDifferential expression analysisExpression patterns, regulatory insights
Structure-functionSite-directed mutagenesis seriesComparative kinetic analysisCritical residues, mechanistic insights

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.