Recombinant Gibberella zeae Palmitoyltransferase PFA4 (PFA4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your requirements to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. To ensure optimal stability, aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PFA4; FGRRES_01411; FGSG_01411; Palmitoyltransferase PFA4; Protein S-acyltransferase; PAT; Protein fatty acyltransferase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-437
Protein Length
full length protein
Species
Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)
Target Names
PFA4
Target Protein Sequence
MAGLNDVPFIKGLAVPSVCALIIFLGYASQFLFNYSTTLEPGPPTRRETIIFNGLLLVLW ITYYRTVATDPGRYIFKDRVIEAEGQRWCNKCAAPKPPRAHHCRHCARCVPRMDHHCPWT RNCVSMTTFPHFLRFLIYTNMSLWMLGYFLWQRFSKIWEHRRLPAYLGPSFYGLICLSLI SIVNFVTTVALGIMLINTVKSWVFNQTMIEGWEQERHEALMDKGPKEWWDIMGPDGEKVR FERLEFPYDIGFFSNMAQAMGTHNVLLWFFPFAGNPTVAKDGNGQGWTWEENGFNRIEGL WPPPDPDKLRRAARGWPAGNRNYAEELRQANMSSSEYKAGFLKRQADDEKRKRHLMAELE EVDDFDMYDDEEYDRELDQGLGWVNSDGDRLRDYGVDEEASEPEGVNDDDDDDDDDDVPL AELIRRRKILKKDGLDD
Uniprot No.

Target Background

Function
PFA4 mediates the reversible addition of palmitate to target proteins, thereby regulating their membrane association and biological function.
Database Links
Protein Families
DHHC palmitoyltransferase family, PFA4 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Gibberella zeae Palmitoyltransferase PFA4 and what is its function?

Palmitoyltransferase PFA4 in Gibberella zeae (sexual stage of Fusarium graminearum) is likely a DHHC-type Zn-finger protein with palmitoyltransferase activity. Based on homology with similar proteins in other fungi, PFA4 belongs to the family of protein S-acyltransferases (EC 2.3.1.225) that catalyze the addition of palmitate to specific proteins . This post-translational modification affects protein localization, stability, and function within the cell.

PFA4 contains the characteristic DHHC palmitoyltransferase domain (Pfam: PF01529.23) and likely has multiple transmembrane domains, as suggested by the predicted two transmembrane regions in the Aspergillus oryzae homolog . The protein modification function mediated by PFA4 may contribute to cellular processes including protein trafficking, membrane association, and potentially virulence-associated pathways in this important plant pathogen.

How is the PFA4 gene organized in the Gibberella zeae genome?

While detailed information about PFA4 gene structure in G. zeae is limited in available literature, we can infer from homologous genes in related fungi that it likely contains multiple exons. For instance, the pfa4 gene in Aspergillus oryzae RIB1133 comprises five exons with the following structure :

  • Exon 1: positions 1-335

  • Exon 2: positions 394-565

  • Exon 3: positions 619-918

  • Exon 4: positions 970-1048

  • Exon 5: positions 1119-1525

The complete gene length in A. oryzae is 1293 bp, encoding a protein of 430 amino acids . Given the evolutionary conservation of this enzyme family across fungal species, a similar multi-exon structure would be expected for G. zeae PFA4, though the specific exon boundaries may differ.

How does G. zeae PFA4 relate to palmitoyltransferases in other fungal species?

G. zeae PFA4 is part of an evolutionarily conserved family of DHHC palmitoyltransferases found throughout the fungal kingdom. Sequence comparison reveals significant homology with palmitoyltransferases from multiple fungal species including:

OrganismProteinE-value compared to A. oryzae PFA4
Aspergillus fumigatusPFA40
Emericella nidulansPFA40
Gibberella zeaePFA46.13884e-100
Neurospora crassaPTR-48.26804e-91
Ustilago maydisPFA44.02557e-51
Debaryomyces hanseniiPFA41.28817e-48
Cryptococcus neoformansPFA45.07138e-47

This strong conservation suggests critical functional roles for these enzymes across diverse fungal lineages . The DHHC domain containing the catalytic site for palmitoyltransferase activity is particularly well-conserved, while other regions of the protein may exhibit greater variability.

What are the recommended approaches for expressing recombinant G. zeae PFA4?

For successful expression of recombinant G. zeae PFA4, researchers should consider the following methodological approach:

Expression System Selection:

  • E. coli systems: While convenient, these may struggle with proper folding of fungal membrane proteins

  • Yeast expression systems (P. pastoris, S. cerevisiae): Better suited for eukaryotic protein expression with appropriate post-translational modifications

  • Fungal host systems: Particularly appropriate when native modifications are essential

Optimized Expression Protocol:

  • Amplify the PFA4 coding sequence from G. zeae genomic DNA using PCR with high-fidelity polymerase

  • For primer design, follow similar approaches as described for PKS4 gene amplification in F. graminearum: denaturation at 94°C for 30s, annealing at 60°C for 1 min, and extension at 72°C for 2 min (35 cycles)

  • Clone the amplified sequence into an appropriate expression vector containing:

    • An inducible promoter (GAL1 for yeast, T7 for E. coli)

    • A purification tag (His6, GST, or MBP)

    • Optional fusion partners to enhance solubility

  • Transform the expression construct into the selected host using standard protocols

  • Screen transformants for expression using Western blot analysis

  • Optimize expression conditions through small-scale tests varying:

    • Temperature (typically lower temperatures improve membrane protein folding)

    • Induction time and inducer concentration

    • Media composition

What are the challenges in purifying recombinant PFA4 and how can they be addressed?

Purification of recombinant PFA4 presents several challenges typical of membrane-associated proteins:

Major Challenges:

  • Membrane association: As a DHHC-type protein, PFA4 likely contains multiple transmembrane domains

  • Protein aggregation: Hydrophobic regions can promote aggregation during expression and purification

  • Maintaining native conformation: Detergent selection is critical for preserving structure and function

  • Low expression yields: Membrane proteins often express at lower levels than soluble proteins

Recommended Purification Strategy:

  • Cell lysis optimization:

    • Use gentle mechanical disruption methods (e.g., French press)

    • Include protease inhibitors to prevent degradation

    • Maintain cold temperatures throughout the process

  • Membrane extraction:

    • Isolate membrane fractions through differential centrifugation

    • Screen detergents for optimal solubilization (start with mild non-ionic detergents like DDM, LMNG, or digitonin)

    • Evaluate detergent efficiency using western blotting and activity assays

  • Affinity purification:

    • Utilize the fusion tag for initial purification (e.g., Ni-NTA for His-tagged proteins)

    • Include detergent in all buffers above critical micelle concentration

    • Consider using detergent-resistant tags such as MBP

  • Further purification:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for additional purity

    • Evaluate protein quality using SDS-PAGE and activity assays

Radioactive Palmitoylation Assay:

  • Incubate purified PFA4 with [³H]- or [¹⁴C]-palmitoyl-CoA and candidate substrate proteins

  • Stop the reaction with SDS sample buffer or TCA precipitation

  • Separate products by SDS-PAGE

  • Visualize palmitoylated proteins by fluorography or phosphorimaging

  • Quantify incorporated radioactivity by scintillation counting of excised gel bands

Click Chemistry-Based Non-Radioactive Assay:

  • Use alkyne-modified palmitoyl-CoA analogs (e.g., 17-octadecynoic acid-CoA) as substrates

  • Perform the enzymatic reaction with purified PFA4 and substrate proteins

  • Subject reaction products to copper-catalyzed azide-alkyne cycloaddition with azide-conjugated fluorophores

  • Analyze labeled proteins by in-gel fluorescence scanning or western blotting

Mass Spectrometry-Based Identification:

  • Conduct in vitro palmitoylation with unlabeled palmitoyl-CoA

  • Digest proteins with trypsin or other appropriate proteases

  • Analyze peptides by LC-MS/MS to identify modified cysteine residues

  • Quantify modification stoichiometry using isotope-labeled internal standards

What gene editing techniques are most effective for studying PFA4 function in Gibberella zeae?

Based on documented transformation methods for Fusarium graminearum, the following approaches are recommended:

Agrobacterium tumefaciens-Mediated Transformation:

This method has been successfully used for gene replacement in F. graminearum and could be applied to PFA4 studies:

  • Construct design:

    • Create a replacement cassette containing a selection marker (hygromycin B resistance gene) flanked by ~2kb homologous regions from the PFA4 locus

    • Clone the fragments as described for PKS4 gene targeting: generate flanking regions by PCR, clone using appropriate restriction enzymes, and assemble the replacement vector

  • Transformation protocol:

    • Transform A. tumefaciens LBA4404 with the replacement construct

    • Co-cultivate with F. graminearum on induction medium

    • Select transformants on media containing hygromycin B (150 ppm)

  • Verification of gene replacement:

    • PCR verification using primers that span the insertion junctions

    • Southern blot analysis using probes specific to the selection marker and deleted region

    • RT-PCR to confirm loss of PFA4 transcript

CRISPR-Cas9 System for Precise Editing:

For more targeted modifications such as point mutations in catalytic residues:

  • Design guide RNAs targeting the DHHC domain or other regions of interest

  • Create repair templates containing desired mutations plus silent mutations that disrupt the PAM site

  • Deliver components using Agrobacterium-mediated transformation

  • Screen transformants by sequencing the target region

The efficiency of CRISPR-Cas9 editing in F. graminearum has improved significantly in recent years, making it a viable alternative to traditional homologous recombination approaches.

Potential Pathogenicity Mechanisms:

  • Secretion and delivery of virulence factors:

    • Protein palmitoylation may regulate the trafficking and secretion of virulence-associated proteins

    • Similar to how the lipase GZEL (encoded by FGL1) has been demonstrated to be crucial for G. zeae pathogenicity

  • Cell wall integrity and morphogenesis:

    • Palmitoylated proteins often function in maintaining fungal cell wall structure

    • Proper morphogenesis is essential for host invasion and colonization

  • Stress adaptation during infection:

    • Pathogens encounter various stresses in the host environment

    • Similar to observations in P. aeruginosa, where Pf4 phage infection alters metabolic pathways and stress responses

  • Regulation of quorum sensing-like systems:

    • Palmitoylation could affect signaling pathways involved in coordinating fungal responses during infection

    • In P. aeruginosa, Pf4 phage infection affects the production of quorum sensing molecules and related virulence factors

Experimental Approaches to Investigate:

  • Generate PFA4 deletion mutants using the transformation techniques described above

  • Compare virulence of wild-type and mutant strains in plant infection assays

  • Analyze changes in the secretome and transcriptome of deletion mutants

  • Identify palmitoylated proteins using proteomics approaches and assess their roles in virulence

What are the structural characteristics of G. zeae PFA4 and how do they relate to function?

While a crystal structure of G. zeae PFA4 is not currently available, insights can be gained from bioinformatics analysis and comparison with related proteins:

Predicted Structural Features:

  • DHHC catalytic domain: The defining feature of palmitoyltransferases, containing the conserved Asp-His-His-Cys motif essential for catalytic activity

  • Transmembrane domains: Likely contains multiple transmembrane segments, as predicted for the A. oryzae homolog (two transmembrane domains)

  • Zinc-finger motif: As a DHHC-type Zn-finger protein, PFA4 likely coordinates zinc ions through conserved cysteine and histidine residues

Structure-Function Relationships:

  • Membrane topology: The orientation of transmembrane domains determines the accessibility of the catalytic site to cytosolic and membrane-associated substrates

  • Substrate recognition: Regions outside the DHHC domain likely contribute to substrate specificity

  • Catalytic mechanism: Similar to other DHHC proteins, catalysis likely proceeds through a two-step process:

    • Formation of a palmitoyl-enzyme intermediate through the catalytic cysteine

    • Transfer of the palmitate to a cysteine residue in the substrate protein

Approaches for Structural Studies:

  • Homology modeling: Using structures of related DHHC proteins as templates

  • Protein engineering: Creating soluble domains or fusion constructs for crystallization

  • Cryo-EM: Potentially suitable for the full-length membrane protein in detergent micelles or nanodiscs

How does PFA4 interact with other biological pathways in Gibberella zeae?

Understanding the interplay between PFA4 and other cellular pathways is critical for comprehending its broader biological roles:

Potential Pathway Interactions:

  • Secondary metabolism:

    • G. zeae produces various polyketides and other secondary metabolites

    • In F. graminearum, studies have shown that one polyketide can influence the expression of others

    • PFA4 might palmitoylate proteins involved in secondary metabolite synthesis or regulation

  • Stress response pathways:

    • Environmental stresses may influence PFA4 expression and activity

    • Similar to observations in other systems where Pf4 phage infection affects genes involved in metabolism and stress response

  • Secretory pathways:

    • PFA4 likely modifies proteins involved in vesicular trafficking and secretion

    • May indirectly affect the secretion of virulence factors like the lipase GZEL

Experimental Approaches to Study Pathway Interactions:

  • Transcriptomics:

    • Compare gene expression profiles between wild-type and PFA4 deletion mutants

    • Analyze PFA4 expression under various stress conditions and during infection

  • Protein-protein interaction studies:

    • Immunoprecipitation coupled with mass spectrometry to identify PFA4 interacting partners

    • Yeast two-hybrid or bimolecular fluorescence complementation to confirm specific interactions

  • Palmitoylome analysis:

    • Identify palmitoylated proteins in G. zeae using metabolic labeling and click chemistry

    • Compare palmitoylation patterns between wild-type and PFA4 mutants

What are promising strategies for screening PFA4 inhibitors as potential antifungals?

Given the potential importance of PFA4 in fungal physiology and possibly pathogenicity, developing inhibitors could have scientific and practical applications:

Inhibitor Screening Approaches:

  • High-throughput enzymatic assays:

    • Adapt the fluorescence-based or radioactive assays described earlier for microplate format

    • Screen chemical libraries for compounds that inhibit PFA4 activity

  • Structure-based design:

    • Using homology models or experimental structures to identify potential binding sites

    • In silico screening followed by experimental validation

  • Phenotypic screening:

    • Test compounds for their ability to phenocopy PFA4 deletion in G. zeae

    • Focus on compounds that affect processes likely dependent on protein palmitoylation

Considerations for Specificity:

  • Selectivity for fungal PFA4 over human DHHC proteins

  • Spectrum of activity against PFA4 homologs in different fungal pathogens

  • Effects on non-target organisms in agricultural settings

How might comparative analysis of PFA4 across Fusarium species inform evolutionary studies?

Expanding research to include PFA4 homologs from multiple Fusarium species could provide insights into evolutionary adaptation:

Comparative Genomics Approach:

  • Identify and align PFA4 sequences from diverse Fusarium species

  • Analyze sequence conservation patterns, particularly in the catalytic domain

  • Examine whether sequence variations correlate with host specificity or geographic distribution

Functional Comparison:

  • Express PFA4 from different species in a common genetic background

  • Compare substrate specificity and activity profiles

  • Assess complementation ability in cross-species experiments

This evolutionary perspective could provide insights into the role of protein palmitoylation in fungal adaptation to different ecological niches and host plants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.