Recombinant Gibberella zeae Peptidyl-prolyl cis-trans isomerase B (CPR2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
CPR2; FGRRES_07439; FGSG_07439; Peptidyl-prolyl cis-trans isomerase B; PPIase B; Rotamase B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-207
Protein Length
Full Length of Mature Protein
Species
Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)
Target Names
CPR2
Target Protein Sequence
AKGPKITHKVYFDITQGDQPLGRVVMGLYGKTVPETTENFRALATGEKGFGYEGSAFHRV IKNFMIQGGDFTKGDGTGGKSIYGDRFKDENFKLKHTKKGLLSMANAGRDTNGSQFFITT VVTSWLDGKHVVFGEVLEGYEIIEKIENSKTGAADRPVEAVKIAKSGELDVPPEGIHVEL
Uniprot No.

Target Background

Function
Peptidyl-prolyl cis-trans isomerases (PPIases) accelerate protein folding by catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Database Links
Protein Families
Cyclophilin-type PPIase family, PPIase B subfamily
Subcellular Location
[Isoform Long]: Membrane; Single-pass membrane protein.; [Isoform Short]: Endoplasmic reticulum lumen.

Q&A

What is Gibberella zeae Peptidyl-prolyl cis-trans isomerase B (CPR2) and what are its primary functions?

Gibberella zeae Peptidyl-prolyl cis-trans isomerase B (CPR2) belongs to the cyclophilin family of PPIases that catalyze the cis-trans isomerization of peptide bonds preceding proline residues. This isomerization is a rate-limiting step in protein folding due to the restricted rotation around the partial double-bonded character of the peptide bond and steric hindrance between adjacent α-carbons . CPR2 typically accelerates this isomerization by factors of 10³-10⁶, facilitating proper protein folding without requiring ATP . In G. zeae, CPR2 likely contributes to fungal development, pathogenicity, and stress adaptation by regulating protein conformation changes that affect multiple cellular processes.

How does CPR2 structurally differ from other PPIases in Gibberella zeae?

While the search results don't provide specific structural information about CPR2 in Gibberella zeae, PPIases generally fall into three distinct families: cyclophilins, FKBPs (FK506-binding proteins), and parvulins . As a cyclophilin, CPR2 would contain the characteristic cyclophilin-like domain responsible for PPIase activity. The cyclophilin family often contains members with additional domains that determine subcellular localization and substrate specificity. For example, some cyclophilins contain RNA recognition motifs (RRMs), TPR domains, or SR-rich regions that facilitate interactions with specific cellular components . These structural variations between different PPIases contribute to their distinct functions and regulatory mechanisms within the fungal cell.

What experimental systems are commonly used to express recombinant CPR2?

For recombinant expression of fungal proteins like CPR2, Escherichia coli is often the first-choice expression system due to its rapid growth, high protein yields, and well-established protocols. To express functional CPR2, researchers typically clone the cDNA sequence into expression vectors containing strong promoters (like T7) and appropriate tags for purification (His, GST, etc.). For eukaryotic post-translational modifications, yeast systems (Saccharomyces cerevisiae or Pichia pastoris) might provide better functionality. When designing expression constructs, it's important to consider codon optimization for the host organism and the addition of protease cleavage sites to remove purification tags if needed for downstream applications.

How does CPR2 contribute to mycotoxin production in Gibberella zeae?

Gibberella zeae is known for producing several mycotoxins, including zearalenone (ZEA) and trichothecenes like deoxynivalenol (DON) and nivalenol (NIV) . While the search results don't directly link CPR2 to mycotoxin production, PPIases can potentially regulate this process through several mechanisms. As transcriptional regulators, PPIases can affect gene expression by modulating the conformation of transcription factors that control mycotoxin biosynthetic gene clusters . For instance, the 50kb segment containing PKS13 and PKS4 genes essential for ZEA biosynthesis in G. zeae might be under regulation influenced by PPIases . Research methodologies to investigate this connection could include generating CPR2 knockout strains and analyzing changes in mycotoxin production using HPLC or LC-MS/MS, combined with transcriptomic analysis of mycotoxin biosynthetic genes.

What are the challenges in obtaining correctly folded and active recombinant CPR2 for structural studies?

Obtaining correctly folded recombinant CPR2 presents several challenges for structural studies. As a protein folding catalyst itself, CPR2 might require specific conditions to achieve its native conformation. Expression in prokaryotic systems like E. coli may result in inclusion body formation, requiring optimization of growth conditions (temperature, IPTG concentration) and the use of solubility-enhancing tags. Refolding protocols from inclusion bodies often involve gradual dilution of denaturants while maintaining redox conditions that favor proper disulfide bond formation. For activity assessment, researchers can employ spectrophotometric assays that measure the rate of peptidyl-prolyl bond isomerization using synthetic peptide substrates. For structural studies, protein samples must meet stringent purity criteria (>95% by SDS-PAGE) and demonstrate monodispersity by dynamic light scattering before attempting crystallization or NMR analysis.

How do environmental stressors affect CPR2 expression and activity in Gibberella zeae?

The expression and activity of PPIases in fungi are often modulated by environmental stressors. In Gibberella zeae, factors such as nutrient starvation, temperature shifts, oxidative stress, and exposure to plant defense molecules like salicylic acid (SA) could potentially affect CPR2 regulation . Research by Linoleic acid isomerase gene FgLAI12 showed that SA affects fungal gene expression and pathogenicity . PPIases might be involved in stress response pathways through their roles in protein folding and transcriptional regulation. To investigate this relationship, researchers could employ RT-qPCR to measure CPR2 expression under various stress conditions, perform western blotting to assess protein levels, and conduct enzyme activity assays to determine functional changes. Additionally, proteomics approaches could identify stress-induced changes in CPR2 interacting partners.

What are the optimal approaches for generating CPR2 knockout mutants in Gibberella zeae?

For generating CPR2 knockout mutants in Gibberella zeae, researchers can employ several methodologies with varying efficiencies:

  • Homologous recombination approach: This traditional method involves replacing the CPR2 gene with a selection marker (e.g., hygromycin resistance) flanked by homologous sequences from the target locus. The targeting construct can be transformed into G. zeae protoplasts using PEG-mediated transformation. This approach has been successfully used for gene disruption in G. zeae as demonstrated in studies of trichothecene biosynthesis genes .

  • CRISPR-Cas9 system: More recently, CRISPR-Cas9 has been optimized for filamentous fungi including Fusarium species. This approach offers higher efficiency and precision, allowing researchers to create marker-free deletions. The system involves designing guide RNAs targeting the CPR2 locus and transforming them along with a Cas9 expression cassette into G. zeae protoplasts.

  • Split-marker approach: This method improves homologous recombination efficiency by using two overlapping fragments of a selection marker, reducing the frequency of ectopic integration.

Verification of knockout mutants should include PCR screening, Southern blot analysis to confirm single integration, and RT-PCR/western blot to verify the absence of CPR2 transcript/protein.

What biochemical assays can accurately measure CPR2 enzymatic activity?

Several biochemical assays can be employed to measure CPR2 enzymatic activity:

  • Chymotrypsin-coupled assay: This classical assay measures the rate of cis-trans isomerization of a proline-containing peptide substrate (e.g., N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide). The cis-to-trans conversion makes the peptide susceptible to chymotrypsin cleavage, releasing p-nitroanilide that can be monitored spectrophotometrically at 390 nm.

  • Protease-free fluorescence assay: Using tetramethylrhodamine (TMR)-labeled peptides containing a proline residue, researchers can monitor conformational changes directly by fluorescence spectroscopy, as the cis and trans isomers exhibit different fluorescence properties.

  • NMR spectroscopy: For more detailed kinetic analysis, NMR spectroscopy allows direct observation of cis and trans isomers in real-time without requiring coupled enzymes.

For accurate activity measurements, it's essential to control temperature (typically 10-15°C to slow down spontaneous isomerization), pH (optimally 7.5-8.0), and substrate concentration. Inhibitors like cyclosporin A can serve as controls to confirm specific cyclophilin activity.

How can protein-protein interactions of CPR2 be effectively mapped in Gibberella zeae?

Mapping protein-protein interactions of CPR2 in Gibberella zeae requires complementary approaches:

  • Yeast two-hybrid (Y2H) screening: Using CPR2 as bait against a cDNA library from G. zeae can identify potential interacting partners. This approach has been widely used for initial screening but may have limitations for membrane-associated or toxic proteins.

  • Co-immunoprecipitation (Co-IP) combined with mass spectrometry: By creating G. zeae strains expressing tagged CPR2 (e.g., FLAG, HA, or GFP tags), researchers can immunoprecipitate the protein complex and identify interacting partners by LC-MS/MS. This approach captures physiologically relevant interactions within the native cellular environment.

  • Bimolecular Fluorescence Complementation (BiFC): This technique allows visualization of protein interactions in living cells by fusing potential interacting partners with complementary fragments of a fluorescent protein. When proteins interact, the fragments reconstitute to produce fluorescence.

  • Cross-linking mass spectrometry (XL-MS): This emerging technique involves chemical cross-linking of interacting proteins followed by MS analysis, providing not only interacting partners but also spatial constraints between them.

Data analysis should incorporate appropriate controls and statistical validation to eliminate false positives, with confirmation of key interactions using multiple methods.

How does CPR2 contribute to virulence mechanisms in Gibberella zeae infection of wheat?

PPIases like CPR2 may contribute to G. zeae virulence through multiple mechanisms, although specific roles of CPR2 aren't detailed in the search results. Based on other fungal systems, CPR2 likely influences pathogenicity through:

  • Stress adaptation: During infection, fungi encounter host defense mechanisms including oxidative bursts and antimicrobial compounds. PPIases help maintain protein function under these stress conditions by ensuring proper folding. G. zeae mutants with altered response to salicylic acid (SA), a plant defense hormone, show reduced virulence , suggesting PPIases might be involved in countering plant defenses.

  • Regulation of virulence gene expression: PPIases can modulate transcription factors that control virulence-associated genes, including those involved in mycotoxin production . In G. zeae, complex gene clusters control production of important virulence factors like zearalenone and trichothecenes .

  • Secretion of virulence factors: Proper folding of secreted enzymes and effectors is essential for host colonization. CPR2 might facilitate folding of these proteins in the secretory pathway.

To investigate these connections, researchers should compare wild-type and CPR2-deficient strains in pathogenicity assays on wheat, analyzing differences in infection progression, host tissue colonization, and mycotoxin accumulation. Transcriptomic and proteomic comparisons would further elucidate CPR2-regulated pathways during infection.

What experimental approaches can determine if CPR2 is a suitable target for antifungal development?

Determining CPR2's suitability as an antifungal target requires systematic evaluation:

  • Essentiality assessment:

    • Generate conditional CPR2 mutants using inducible promoters to determine if complete loss is lethal

    • Perform growth and virulence assays to quantify the impact of CPR2 deficiency

    • The target should ideally be essential or significantly impact pathogenicity

  • Druggability analysis:

    • Structural analysis (X-ray crystallography or homology modeling) to identify potential binding pockets

    • In silico screening to predict compound binding affinity

    • Biochemical assays to test inhibitor candidates against recombinant CPR2

  • Specificity evaluation:

    • Comparative analysis with human cyclophilins to identify structural differences

    • Design of selectivity assays testing compounds against both fungal CPR2 and human homologs

    • The ideal inhibitor should show >100-fold selectivity for fungal enzymes

  • In vivo efficacy testing:

    • Evaluation of lead compounds using both in vitro fungal cultures and plant infection models

    • Assessment of toxicity in plant systems

    • Pharmacokinetic studies to determine stability and distribution in plant tissues

The experimental data should be compiled into a comprehensive target validation package that includes quantitative measurements of inhibition constants, growth inhibition, and disease reduction percentages.

How are omics approaches enhancing our understanding of CPR2 function in Gibberella zeae?

Omics technologies offer powerful platforms for understanding CPR2 function in a systems biology context:

  • Transcriptomics: RNA-seq comparison between wild-type and CPR2 mutants can reveal gene expression networks regulated by this PPIase. Under different conditions (e.g., during infection, nutrient starvation, or pH stress), such analysis can identify condition-specific roles. Previous studies have shown that transcription of genes in G. zeae is strongly influenced by culture conditions such as nutrient starvations and ambient pH , suggesting PPIases like CPR2 may play roles in these adaptive responses.

  • Proteomics: Quantitative proteomics can identify proteins with altered abundance or modifications in CPR2 mutants. Particularly relevant are phosphoproteomic studies, as proline-directed phosphorylation is often coupled with prolyl isomerization. For G. zeae, comparing proteomes during various developmental stages could reveal CPR2's role in life cycle transitions.

  • Interactomics: Affinity purification-mass spectrometry (AP-MS) can map the dynamic interactome of CPR2 under different conditions. This approach has revealed that PPIases interact with transcription factors, RNA polymerase II, and chromatin modifiers in other systems .

  • Metabolomics: Given G. zeae's production of numerous secondary metabolites including mycotoxins, metabolomic comparison between wild-type and CPR2 mutants could reveal roles in metabolic regulation, particularly under conditions that favor mycotoxin production.

These multi-omics approaches should be integrated using systems biology tools to develop comprehensive models of CPR2 function within fungal regulatory networks.

What are the emerging techniques for studying CPR2 dynamics in living Gibberella zeae cells?

Several cutting-edge techniques are emerging for studying PPIase dynamics in living cells that could be applied to CPR2 in G. zeae:

  • FRET-based biosensors: Genetically encoded sensors can be designed to monitor CPR2 activity in real-time by detecting conformational changes in substrate proteins. These biosensors typically consist of a CPR2 substrate sequence flanked by fluorescent proteins that undergo FRET changes upon isomerization.

  • Optogenetic control of CPR2: Light-responsive domains can be fused to CPR2 to enable spatiotemporal control of its activity, allowing researchers to study the immediate effects of CPR2 activation/inhibition in specific cellular compartments.

  • Live-cell single-molecule tracking: By tagging CPR2 with photoactivatable fluorescent proteins, researchers can track individual molecules to determine diffusion rates, binding kinetics, and localization patterns during different cellular processes.

  • CRISPR-based imaging: CRISPR-Cas systems adapted for RNA tracking can be used to visualize CPR2 mRNA localization and translation dynamics.

  • Fluorescence correlation spectroscopy (FCS): This technique can measure diffusion coefficients and concentrations of fluorescently labeled CPR2, providing insights into its mobility and interactions in different cellular compartments.

Implementation of these techniques in G. zeae would require optimization of transformation protocols, selection of appropriate fluorescent tags that maintain CPR2 function, and development of sophisticated imaging platforms capable of monitoring fungal cells during host infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.