Recombinant Gibberella zeae Protein SYM1 (SYM1)

Shipped with Ice Packs
In Stock

Description

Introduction

Gibberella zeae is a fungus known for its impact on agriculture and its ability to produce mycotoxins that affect the health of humans and animals . Understanding the molecular mechanisms that govern its growth, development, and virulence is crucial for mitigating its harmful effects . Recombinant proteins derived from G. zeae are valuable tools in studying these mechanisms. One such protein is SYM1, which plays a significant role in the fungus's various biological processes .

Functional Analysis of Heterotrimeric G Proteins

Heterotrimeric G proteins in G. zeae are essential signaling molecules that regulate vegetative growth, sexual development, toxin production, and pathogenicity . These proteins consist of Gα, Gβ, and Gγ subunits . Studies involving the manipulation of G protein subunits have provided insights into their functions:

  • GzGPA1: Deletion of GzGPA1, a homolog of the Aspergillus nidulans Gα gene fadA, results in female sterility and increased production of deoxynivalenol (DON) and zearalenone (ZEA) . This suggests GzGPA1 is necessary for normal sexual reproduction and the repression of toxin biosynthesis .

  • GzGPB1: Mutants of GzGPB1 also show enhanced production of DON and ZEA, indicating that both Gα GzGPA1 and Gβ GzGPB1 negatively control mycotoxin production .

  • GzGPA2: Deletion of GzGPA2, a Gα protein similar to A. nidulans GanB, leads to reduced pathogenicity and increased chitin accumulation in the cell wall, suggesting multiple functions for GzGPA2 .

Mycotoxin Production in G Protein Mutants

Studies have shown that G protein mutants produce significantly more DON and ZEA than wild-type strains . For example, GzGPA1 and GzGPB1 mutants can produce significantly more DON and ZEA than the wild-type strain .

SNF1 Protein Kinase and its Role in G. zeae Development

The sucrose nonfermenting 1 (SNF1) protein kinase plays a vital role in the transcription of glucose-repressible genes in response to glucose starvation . Deleting the SNF1 ortholog (GzSNF1) from G. zeae results in reduced mycelial growth on various carbon sources and decreased virulence on barley . Mutants exhibit impaired sexual and asexual development, producing fewer perithecia with abnormal ascospores .

FeatureWild TypeΔGzSNF1 Mutants
Mycelial GrowthNormalReduced
Virulence on BarleyNormalDecreased
Perithecia ProductionNormalReduced (30%)
Ascospore DevelopmentNormalAbnormal
Perithecia Maturation SpeedNormalDelayed

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SYM1; FGRRES_00730; FGSG_00730; Protein SYM1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)
Target Names
SYM1
Target Protein Sequence
MSSFIRWYNSRLAARPLLTQSVTTAFLFATGDVTAQQLVEKRGAQKHDLVRTGRMALYGG FVFGPVATTWFAFLARRVNVRNNKKAEVLARVACDQLGFAPVMIGVFLSSMATMEGKSVK ERIDKTWWPALKANWMVWPAVQVINFSLIPLQYRLFFANIIAIGWNSYLSWVNSQ
Uniprot No.

Target Background

Function
This protein may be involved in cellular stress responses and is essential for maintaining the integrity and stability of mitochondrial DNA (mtDNA).
Database Links
Protein Families
Peroxisomal membrane protein PXMP2/4 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does SYM1 compare to its orthologs in other organisms?

SYM1 from G. zeae shares significant functional similarities with its yeast counterpart in Saccharomyces cerevisiae. The human ortholog of SYM1 is MPV17, which is related to mitochondrial DNA depletion syndrome (MDDS) . Studies on yeast have shown that deletion of the sym1 gene leads to lysine auxotrophy, suggesting its involvement in amino acid metabolism regulation . The protein is conserved across fungal species but does not have distinct homologs in the phyla Oomycota and Basidiomycota .

Research has demonstrated that SYM1 orthologs across species appear to play critical roles in mitochondrial function, particularly in stress response pathways. Comparative analyses of SYM1 proteins from different organisms provide insights into evolutionary conservation of mitochondrial membrane proteins and their functions in cellular metabolism.

What is the cellular localization of SYM1 in Gibberella zeae?

Based on studies using GFP-tagged SYM1 proteins, SYM1 predominantly localizes to the mitochondria, specifically in the inner mitochondrial membrane . This localization is consistent with its proposed function in maintaining mitochondrial DNA integrity. To determine subcellular localization, researchers have used fluorescence microscopy techniques with proteins fused to markers such as GFP. The mitochondrial localization pattern is similar to what has been observed with the yeast ortholog, where Sym1 is a mitochondrial inner membrane protein .

How can recombinant SYM1 be expressed and purified for experimental studies?

Recombinant SYM1 protein can be produced using several expression systems, with E. coli being the most commonly employed host. The methodology typically involves:

  • Gene Cloning: The full-length SYM1 coding sequence (1-175 amino acids) is PCR-amplified and cloned into an appropriate expression vector, often with an N-terminal His-tag for purification purposes .

  • Expression Conditions: The protein is expressed in E. coli with optimal induction parameters (temperature, IPTG concentration, duration).

  • Purification Protocol: Purification is typically performed using:

    • Immobilized metal affinity chromatography (for His-tagged protein)

    • Buffer conditions: Tris/PBS-based buffer, pH 8.0, often supplemented with 6% trehalose for stability

    • The purified protein is stored in a buffer containing 50% glycerol at -20°C or -80°C

  • Quality Control:

    • Purity assessment: >90% as determined by SDS-PAGE

    • Western blot confirmation

    • Functional assays to ensure biological activity

For long-term storage, it is recommended to add 5-50% glycerol (final concentration) and aliquot for storage at -20°C/-80°C. Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

What metabolic pathways are affected by SYM1 deletion in fungi?

Studies on SYM1 orthologs, particularly in yeast, have revealed several metabolic pathways affected by SYM1 deletion:

  • Lysine Metabolism: Deletion of sym1 in yeast results in lysine auxotrophy, indicating that the protein plays a crucial role in lysine biosynthesis. Interestingly, lysine biosynthesis intermediates like 2-aminoadipate (2-AAA) and saccharopine accumulate in sym1Δ cells, suggesting an impairment in either lysine biosynthesis or degradation .

  • Pyrimidine Metabolism: SYM1 deletion leads to reduced levels of pyrimidine biosynthesis intermediates, including carbamoyl-aspartate and orotic acid, indicating a potential role of SYM1 in nucleotide metabolism .

  • Arginine Metabolism: Reduction of arginine and increase of citrulline in sym1Δ cells has been observed, resembling heat stress-induced remodeling of arginine metabolism .

The metabolic profile observed in SYM1-deficient cells suggests a stress-like state even under normal growth conditions, which may explain why these cells cannot survive at elevated temperatures (37°C) .

How can compartment-specific metabolomics be applied to study SYM1 function?

Compartment-specific metabolomics offers valuable insights into SYM1 function by distinguishing between mitochondrial and cytoplasmic metabolic changes. The methodology involves:

  • Sample Preparation:

    • Isolation of mitochondria from wild-type and SYM1-deleted cells

    • Separation of cytoplasmic and mitochondrial fractions

    • Quality control to ensure subcellular fractionation purity

  • Analytical Approaches:

    • Gas chromatography-mass spectrometry (GC-MS) for metabolic profiling

    • Targeted liquid chromatography-mass spectrometry (LC-MS) for specific metabolites

    • Ultra-high performance liquid chromatography-quadrupole time of flight mass spectrometry (UHPLC-QTOF-MS) for untargeted analyses

  • Data Analysis Pipeline:

    • Principal component analysis (PCA) to distinguish compartmental differences

    • Heat map generation for visualizing significantly changed metabolites

    • Statistical analysis (ANOVA) to identify significant metabolic alterations

This approach has revealed distinct metabolic patterns between cytoplasm and mitochondria in SYM1-deficient cells, with greater shifts observed in cytoplasmic metabolism compared to mitochondrial metabolism .

What is the relationship between SYM1 and mitochondrial DNA maintenance?

Based on homology with its yeast ortholog and the human MPV17 protein, SYM1 is believed to play a crucial role in maintaining mitochondrial DNA integrity. The evidence supporting this function includes:

  • Deletion of SYM1 orthologs leads to mitochondrial dysfunction, particularly evident in yeast models .

  • The human ortholog MPV17 is associated with mitochondrial DNA depletion syndrome (MDDS), a severe condition characterized by reduced mitochondrial DNA copy number .

  • Metabolic alterations in SYM1-deficient cells reflect mitochondrial stress, which may indirectly affect mitochondrial DNA stability.

  • SYM1 localizes to the mitochondrial inner membrane, positioning it appropriately to influence mitochondrial DNA maintenance mechanisms.

Research methodologies to investigate this relationship typically involve:

  • Measuring mitochondrial DNA copy number in SYM1-deficient cells

  • Assessing mitochondrial membrane potential using fluorescent dyes

  • Evaluating reactive oxygen species levels and oxidative damage to mitochondrial DNA

  • Complementation studies with orthologs from different species

How might SYM1 contribute to stress response in Gibberella zeae?

While direct evidence for SYM1's role in G. zeae stress response is limited, insights from studies on orthologs suggest several potential mechanisms:

  • Maintenance of Mitochondrial Function: By preserving mitochondrial DNA integrity, SYM1 likely ensures proper energy production during stress conditions.

  • Metabolic Adaptation: The involvement of SYM1 in amino acid metabolism (particularly lysine) may facilitate adaptation to nutrient-limited environments during host colonization.

  • Redox Homeostasis: Mitochondrial membrane proteins often contribute to cellular redox balance, which is critical during oxidative stress encountered during plant infection.

Experimental approaches to investigate SYM1's role in stress response include:

  • Gene expression analysis of SYM1 under various stress conditions (heat, oxidative, osmotic)

  • Phenotyping SYM1-deletion mutants under stress conditions

  • Comparative metabolomics of wild-type vs. SYM1-deficient strains under stress

  • Complementation studies with stress-responsive promoters

How does SYM1 compare functionally to other mitochondrial proteins in Gibberella zeae?

G. zeae possesses multiple mitochondrial proteins involved in diverse functions. Comparative functional analysis of SYM1 with other mitochondrial proteins reveals:

  • Unlike mitochondrial transcription factors (e.g., MYT1), which regulate gene expression and affect sexual reproduction in G. zeae , SYM1 appears more directly involved in metabolic processes and mitochondrial membrane function.

  • In contrast to G-protein signaling components that regulate various cellular processes including toxin production , SYM1's function seems more specialized toward mitochondrial homeostasis.

  • Unlike some mitochondrial proteins that directly affect pathogenicity, the role of SYM1 in virulence may be more subtle, potentially influencing survival under stress conditions encountered during host colonization.

Research methodologies for comparative functional analysis include:

  • Protein-protein interaction studies to identify functional partners

  • Comparative transcriptomics of various mitochondrial protein mutants

  • Phenotypic characterization across multiple growth and stress conditions

  • Metabolomic profiling to identify shared or distinct metabolic impacts

What techniques are available for studying SYM1 protein-protein interactions?

Several complementary approaches can be employed to investigate SYM1's protein interaction network:

  • Yeast Two-Hybrid (Y2H) Screening:

    • SYM1 is used as bait to identify potential interacting proteins

    • Suitable for detecting direct binary interactions

    • May require optimization for membrane proteins like SYM1

  • Co-Immunoprecipitation (Co-IP):

    • Using antibodies against tagged SYM1 to pull down interaction partners

    • Followed by mass spectrometry identification

    • Preserves native protein complexes

  • Proximity-Dependent Biotin Identification (BioID):

    • Fusion of SYM1 with a biotin ligase

    • Biotinylation of proximal proteins in the native cellular environment

    • Particularly useful for membrane proteins and transient interactions

  • Split-GFP Complementation Assays:

    • Confirmation of specific interactions identified by other methods

    • Visualization of the subcellular location of interactions

    • Can be adapted for high-throughput screening

  • Crosslinking Mass Spectrometry:

    • Chemical crosslinking of protein complexes in vivo

    • Mass spectrometry analysis of crosslinked peptides

    • Provides spatial constraints for molecular modeling

Identified interaction partners can provide valuable insights into SYM1's functional role in mitochondrial processes and potential involvement in stress response pathways.

What are the optimal conditions for studying the functional activity of recombinant SYM1?

To assess the functional activity of recombinant SYM1, researchers should consider the following conditions and approaches:

  • Buffer Composition:

    • Tris/PBS-based buffer, pH 8.0

    • Addition of 6% trehalose for protein stability

    • Inclusion of appropriate cofactors based on hypothesized function

  • Membrane Reconstitution:

    • As a mitochondrial membrane protein, SYM1 may require incorporation into liposomes or nanodiscs for functional studies

    • Lipid composition mimicking the mitochondrial inner membrane is recommended

  • Functional Assays:

    • Reconstitution in artificial membrane systems to study transport properties

    • Measurement of mitochondrial DNA binding capacity using electrophoretic mobility shift assays

    • Assessment of protein stability under various stress conditions (temperature, pH, oxidative)

  • Complementation Studies:

    • Expression of recombinant SYM1 in sym1Δ yeast cells to assess rescue of phenotypes

    • Cross-species complementation to determine functional conservation

  • Activity Measurement Parameters:

    • Temperature range: 23-30°C (based on optimal growth conditions for G. zeae)

    • pH range: 6.5-8.0

    • Ionic strength: physiological conditions (approximately 150 mM salt)

How can researchers design experiments to compare SYM1 function across different fungal species?

Comparative functional analysis of SYM1 across fungal species requires careful experimental design:

  • Sequence and Structure Analysis:

    • Multiple sequence alignment of SYM1 orthologs

    • Identification of conserved domains and species-specific variations

    • Structural modeling to predict functional differences

  • Heterologous Expression System:

    • Expression of SYM1 orthologs from different species in a common host (e.g., S. cerevisiae sym1Δ)

    • Assessment of complementation efficiency

    • Creation of chimeric proteins to identify functionally important regions

  • Phenotypic Characterization Matrix:

    • Systematic testing of growth under various conditions (temperature, carbon sources, stress)

    • Analysis of mitochondrial function (membrane potential, respiration rate)

    • Metabolomic profiling to identify species-specific metabolic signatures

  • Standardized Interaction Studies:

    • Y2H or affinity purification-mass spectrometry using the same experimental conditions

    • Comparison of interaction networks across species

    • Identification of conserved and species-specific interaction partners

  • Evolutionary Rate Analysis:

    • Calculation of dN/dS ratios to identify selection pressures

    • Correlation of evolutionary rates with functional divergence

    • Ancestral sequence reconstruction to trace functional evolution

Such comparative approaches can reveal how SYM1 function has diversified across fungal species and provide insights into its core conserved roles.

What approaches can be used to study the impact of SYM1 on mitochondrial function in Gibberella zeae?

To investigate SYM1's impact on mitochondrial function in G. zeae, researchers can employ several complementary approaches:

  • Mitochondrial Isolation and Functional Assays:

    • Isolation of intact mitochondria from wild-type and SYM1-deficient strains

    • Measurement of oxygen consumption rates and ATP production

    • Assessment of mitochondrial membrane potential using fluorescent probes

    • Evaluation of reactive oxygen species production

  • Mitochondrial DNA Analysis:

    • Quantification of mtDNA copy number using qPCR

    • Analysis of mtDNA integrity using long-range PCR

    • Assessment of mtDNA mutation rates through next-generation sequencing

    • Visualization of nucleoids using fluorescence microscopy

  • Ultrastructural Studies:

    • Transmission electron microscopy to examine mitochondrial morphology

    • Immunogold labeling to localize SYM1 within the mitochondria

    • Tomographic reconstruction to analyze mitochondrial membrane structure

  • In vivo Mitochondrial Imaging:

    • Live-cell imaging using mitochondria-targeted fluorescent proteins

    • Analysis of mitochondrial dynamics (fusion, fission, motility)

    • FRET-based sensors to measure metabolite levels in mitochondria

  • Mitochondrial Proteomics and Lipidomics:

    • Comparative analysis of mitochondrial proteome from wild-type and mutant strains

    • Assessment of mitochondrial lipid composition

    • Identification of post-translational modifications in mitochondrial proteins

These approaches provide a comprehensive assessment of how SYM1 impacts various aspects of mitochondrial biology in G. zeae.

What methodologies are recommended for resolving contradictions in experimental data about SYM1 function?

When faced with contradictory experimental results regarding SYM1 function, researchers should adopt a systematic approach to resolution:

  • Replicate Independent Experiments:

    • Perform biological and technical replicates using standardized protocols

    • Calculate statistical power to ensure adequate sample sizes

    • Consider blind experimental design to eliminate bias

  • Cross-Validate Using Multiple Techniques:

    • Employ orthogonal methodologies to address the same question

    • For example, combine genetic approaches with biochemical and structural studies

    • Consider in vivo, in vitro, and in silico approaches

  • Control for Context-Dependent Effects:

    • Systematically vary experimental conditions (temperature, media, growth phase)

    • Test different genetic backgrounds to identify strain-specific effects

    • Consider environmental factors that might influence results

  • Meta-Analysis of Existing Data:

    • Compile and statistically analyze all available data

    • Identify patterns across studies that might explain discrepancies

    • Consider publication bias in the assessment

  • Experimental Decision Tree:

Contradiction TypeRecommended ApproachAnalytical Method
Function in different speciesCross-species complementationPhenotypic analysis, metabolomics
Subcellular localizationMulti-tag approach with different fixation methodsConfocal microscopy, subcellular fractionation
Metabolic impactStable isotope labelingFlux analysis, targeted metabolomics
Protein interactionsMultiple interaction detection methodsNetwork analysis, structural modeling
Phenotypic effectsControlled environmental conditionsPrincipal component analysis of phenotypic data

How can researchers use systems biology approaches to understand SYM1's role in fungal metabolism?

Systems biology offers powerful tools to integrate multiple data types and reveal SYM1's role in metabolic networks:

  • Multi-Omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data from SYM1-deficient vs. wild-type strains

    • Identify perturbed pathways and regulatory networks

    • Use time-course experiments to capture dynamic responses

  • Metabolic Flux Analysis:

    • Apply 13C metabolic flux analysis to quantify changes in metabolic pathway activities

    • Identify redirected carbon flows in response to SYM1 deletion

    • Determine which metabolic pathways are most sensitive to SYM1 function

  • Network Modeling:

    • Construct genome-scale metabolic models incorporating SYM1 constraints

    • Perform flux balance analysis to predict metabolic outcomes

    • Validate model predictions with targeted experiments

  • Constraint-Based Approaches:

    • Apply constraints derived from experimental data to refine metabolic models

    • Use enzyme capacity constraints based on proteomics data

    • Incorporate thermodynamic constraints to improve prediction accuracy

  • Metabolic Control Analysis:

    • Determine flux control coefficients for key pathways affected by SYM1

    • Identify rate-limiting steps in metabolic pathways

    • Quantify the sensitivity of different pathways to SYM1 activity

By integrating these systems approaches, researchers can move beyond individual pathways to understand SYM1's role in the broader metabolic network of Gibberella zeae.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.