Recombinant Gibberella zeae Rhomboid protein 2 (RBD2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
RBD2; FGRRES_07954; FGSG_07954; Rhomboid protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)
Target Names
RBD2
Target Protein Sequence
MRPRLQNFNALRARSYLTRLPLFTRLIVLAIIALSIASLQSVWNLREWGALIPEEISITN AYRLSTFPLIHLNVIHAILNLLALTPLMERFETEHGTLTSLALFFGPLTSIPAVAYVLIE RCIFRANHGVLGASMWVFTLLAMESIQTYKSNPHFVIGSVNIPTWTTPLIMSLVVAALIP GTSLLGHLCGIAIGYVAGFGYAKLLAPPEWGLRWVENRLNLLKILPHYVSIDKTTYGRFG VLPTTNRPGPSGSAATELVGTTQRLGP
Uniprot No.

Target Background

Function
Probable serine protease.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is Gibberella zeae Rhomboid protein 2 (RBD2) and what is its significance in research?

RBD2 (UniProt ID: Q4I4A4) is a serine protease (EC 3.4.21.-) belonging to the rhomboid family of intramembrane proteases found in Gibberella zeae (also known as Fusarium graminearum), a fungal plant pathogen responsible for fusarium head blight (FHB) in cereal crops. This pathogen causes billions of dollars in economic losses worldwide annually, contaminating grain with harmful mycotoxins including deoxynivalenol (DON) and zearalenone . RBD2 is part of the evolutionarily conserved rhomboid protease family found across all life forms from bacteria to mammals, suggesting fundamental biological importance . The protein consists of 267 amino acids with multiple transmembrane domains typical of rhomboid proteases, and its study may provide critical insights into fungal pathogenesis mechanisms .

What is the molecular structure and basic properties of recombinant RBD2?

Recombinant RBD2 is a full-length protein spanning amino acids 1-267 with the sequence starting with MRPRLQNFNAL and ending with VLPTTNRPGPSGSAATELVGTTQRLGP . The protein is typically produced with an N-terminal His tag in E. coli expression systems and purified to >90% purity as determined by SDS-PAGE . As a rhomboid protease, RBD2 likely contains multiple transmembrane domains that form a core catalytic structure within the membrane. The recombinant protein has a molecular weight of approximately 30 kDa and is typically stored in a Tris/PBS-based buffer with either 50% glycerol or 6% trehalose at pH 8.0 to maintain stability . The protein's protease activity is characteristic of the rhomboid family, which typically cleave substrate proteins within their transmembrane domains .

What expression systems and purification methods are used for recombinant RBD2?

The predominant expression system for recombinant RBD2 is Escherichia coli, with the protein being expressed as a fusion construct containing an N-terminal His tag to facilitate purification . The expression construct contains the full-length protein sequence (amino acids 1-267) from Gibberella zeae. After expression, the protein is typically purified using affinity chromatography, leveraging the His tag's affinity for metal ions such as nickel or cobalt . The purified protein is then subject to quality control measures including SDS-PAGE to confirm purity (typically >90%) . After purification, the protein is often lyophilized for long-term storage and stability. For experimental use, the lyophilized protein can be reconstituted in deionized sterile water to concentrations of 0.1-1.0 mg/mL, with recommendations to add 5-50% glycerol for aliquoting and storage at -20°C or -80°C .

What are the optimal storage and handling conditions for recombinant RBD2?

For optimal stability and activity retention, recombinant RBD2 should be stored according to the following validated protocols:

  • Long-term storage: Maintain at -20°C to -80°C in a Tris/PBS-based buffer containing either 50% glycerol or 6% trehalose at pH 8.0 .

  • Working solutions: Store aliquots at 4°C for no more than one week to maintain activity .

  • Reconstitution procedure: Briefly centrifuge vials before opening to bring contents to the bottom. Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Aliquoting recommendations: Add glycerol to a final concentration of 5-50% (with 50% being the standard recommended concentration) before creating working aliquots to prevent protein degradation during freeze-thaw cycles .

  • Stability considerations: Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein activity and structural integrity .

How does the exosite of rhomboid proteases like RBD2 affect substrate specificity and catalytic efficiency?

The exosite of rhomboid proteases plays a crucial role in substrate recognition and catalytic efficiency. Molecular dynamics (MD) computational studies of GlpG rhomboid protease, which shares structural similarities with RBD2, have revealed that the exosite provides the initial binding contact for intramembrane protein substrates prior to catalysis . This binding step is essential for proteolytic activity, as demonstrated by experiments showing that peptidyl aldehydes act as non-competitive inhibitors of intramembrane substrate hydrolysis by binding to the active site while not competing with substrates for exosite binding .

The conformational changes induced by substrate binding at the exosite significantly impact catalytic efficiency. Research has shown that the transmembrane domain (TMD) of the substrate bound to the rhomboid protease exosite undergoes unwinding, which is essential for proper positioning of the scissile bond in the active site . Quantitative analyses demonstrate that truncating the TMD by more than five amino acids from the substrate C-terminus decreases cleavage rates significantly, with one study calculating that the fraction of catalytically productive non-covalent complex conformers of short 11-amino acid peptide substrates is 53 times smaller than that of 33-amino acid substrates containing a TMD domain . This provides mechanistic evidence that rhomboid proteases like RBD2 are specifically adapted for processing substrates with transmembrane domains rather than short peptides .

What methods are available for studying RBD2's enzymatic activity and substrate specificity?

Multiple complementary methodologies can be employed to comprehensively characterize RBD2's enzymatic properties:

  • Computational approaches: Molecular dynamics (MD) simulations can model RBD2's catalytic mechanism based on crystallographic data and sequence homology with other rhomboid proteases . These simulations can predict how the exosite controls substrate hydrolysis kinetics and how inhibitors interact with the active site.

  • In vitro enzymatic assays: Using purified recombinant RBD2, researchers can develop fluorogenic peptide substrates containing quencher-fluorophore pairs that emit measurable signals upon cleavage. Kinetic parameters (Km, kcat, kcat/Km) can be determined under various conditions to assess factors affecting enzymatic efficiency.

  • Substrate identification: A proteomics approach combining immunoprecipitation with mass spectrometry can identify physiological substrates. Studies on F. graminearum secretomes have identified 289 secreted proteins (229 in vitro and 120 in planta), providing potential substrate candidates for RBD2 .

  • Genetic approaches: Targeted gene disruption techniques, similar to those used for GzCHS5 and GzCHS7 in G. zeae, can be employed to create ΔRbd2 mutants, enabling assessment of phenotypic changes in hyphal growth, morphology, cell wall integrity, perithecia formation, and pathogenicity .

  • Inhibitor screening: High-throughput screening of compound libraries can identify inhibitors specific to RBD2. Known inhibitors of other rhomboid proteases, such as peptidyl aldehydes that act as non-competitive inhibitors, provide a starting point for such screens .

What is the role of RBD2 in the protein-protein interaction network of Fusarium graminearum?

The Fusarium graminearum protein-protein interaction (FPPI) database provides a comprehensive framework for understanding potential RBD2 interactions within the pathogen's interactome. This database contains 223,166 interactions among 7,406 proteins, covering approximately 52% of the F. graminearum proteome . While specific RBD2 interactions are not explicitly detailed in the search results, this resource facilitates network analysis to identify potential functional partners.

The FPPI database was constructed using both interolog-based predictions from seven species and experimentally determined domain-domain interactions based on protein structures . A core high-confidence PPI data set consisting of 27,102 interactions among 3,745 proteins has been experimentally validated through yeast two-hybrid experiments, with one randomly selected protein pair confirmed to interact, supporting the reliability of these predictions .

For studying RBD2-specific interactions, researchers should consider that rhomboid proteases typically interact with their substrates transiently during catalysis. Substrate trapping mutants, where catalytic residues are mutated to stabilize enzyme-substrate complexes, could be employed to identify RBD2 interaction partners. Additionally, analysis of RBD2 expression patterns in relation to the 289 proteins identified in the F. graminearum secretome (including 49 proteins found exclusively in planta) could reveal potential substrates relevant to pathogenesis .

How might RBD2 contribute to Fusarium graminearum's virulence mechanisms?

RBD2 likely plays a significant role in F. graminearum pathogenesis through several potential mechanisms, though specific pathways await experimental verification:

  • Protein processing during infection: F. graminearum secretes numerous proteins during wheat head infection, with 120 proteins identified in planta, of which 49 were not found under any in vitro conditions . As an intramembrane protease, RBD2 may process key virulence factors within this secretome, potentially activating toxins or invasion-related proteins.

  • Cell wall integrity regulation: Studies of other F. graminearum proteins like GzCHS5 and GzCHS7 (chitin synthases) have shown they are indispensable for perithecia formation and pathogenicity . Mutants lacking these proteins formed abnormal balloon-shaped hyphae, exhibited intrahyphal hyphae, and showed weakened cell wall rigidity compared to wild-type strains . RBD2 may similarly influence cell wall composition or integrity through processing of membrane proteins involved in cell wall synthesis.

  • Sexual reproduction: F. graminearum's sexual spores (ascospores) play a crucial role as primary inocula in the disease cycle . These spores are forcibly discharged from perithecia and can germinate within six hours upon landing on plant surfaces . RBD2 might be involved in the development of these reproductive structures, similar to the role of GzCHS5 and GzCHS7, which when disrupted resulted in defects in perithecia formation .

  • Host-pathogen communication: Several proteins lacking signal peptides found only in planta have been reported to be potent immunogens secreted by animal pathogenic fungi, and these could be important in the interaction between F. graminearum and its host plants . RBD2 might process such proteins, influencing host immune responses.

How does RBD2 compare evolutionarily to other rhomboid proteases across different species?

Rhomboid proteases constitute an evolutionarily ancient and conserved family of intramembrane serine proteases found across all domains of life. Comparative genomic analyses have identified related genes in organisms as diverse as bacteria, archaebacteria, plants, yeast, and mammals, suggesting that the primordial function of these proteins addresses fundamental cellular processes .

The evolutionary relationship between rhomboid family members shows a consistent pattern where the transmembrane domains represent the most highly conserved regions, while the hydrophilic amino-terminal portions show significant divergence . This pattern suggests that the transmembrane domains provide the core proteolytic function, while the variable regions may confer substrate specificity or regulatory mechanisms unique to each organism's biological needs.

In Drosophila, seven rhomboid-like genes have been identified, with Rhomboid-1 and Rhomboid-3 (also known as Roughoid) functioning cooperatively in the Epidermal Growth Factor Receptor (EGFR) signaling pathway . Phylogenetic analyses indicate that Rhomboid-3 is most closely related to Rhomboid-1, followed by Rhomboid-2, with Rhomboid-4 being more distantly related . This evolutionary pattern suggests functional specialization within a single organism.

RBD2 from Fusarium graminearum likely represents a fungal-specific adaptation of the core rhomboid protease functionality. While mammalian inactive rhomboid protein 2 (iRhom2) has been studied for its role in regulating inflammation through control of TNF-α shedding from immune cells , RBD2 in F. graminearum appears to be an active protease (EC 3.4.21.-) that may have evolved specific functions related to fungal cell biology and plant pathogenesis.

What inhibitors or modulators of RBD2 activity have been identified, and how might they be developed for antifungal applications?

While specific inhibitors targeting RBD2 have not been explicitly identified in the search results, research on related rhomboid proteases provides valuable insights for inhibitor development:

  • Peptidyl aldehydes: These compounds have been identified as non-competitive inhibitors of intramembrane substrate hydrolysis by GlpG rhomboid protease . Unlike their interaction with soluble serine proteases where they act as competitive reversible covalent inhibitors, their non-competitive mode of action with rhomboid proteases suggests binding at sites distinct from substrate binding regions .

  • Mechanism-based design approach: Understanding that rhomboid proteases utilize an exosite for initial substrate binding provides a rational strategy for inhibitor design. Compounds that can interfere with substrate recognition at the exosite while also blocking the catalytic site could provide dual-action inhibition .

  • Transmembrane domain mimetics: Given that rhomboid proteases show preference for substrates with transmembrane domains , peptide-based inhibitors mimicking these domains but containing non-cleavable bonds at the scissile site position could serve as effective competitive inhibitors.

  • Development methodology: A systematic approach for RBD2 inhibitor development would involve:

    • Initial screening using recombinant RBD2 and fluorogenic substrates

    • Structural characterization of inhibitor-enzyme complexes

    • Assessment of fungal growth inhibition and effects on pathogenicity

    • Evaluation of host plant effects and environmental impact

    • Optimization for stability in agricultural applications

Potential therapeutic applications could target not only crop protection against F. graminearum but might also inform development of broader antifungal agents affecting rhomboid proteases in multiple pathogenic fungi.

How can recombinant RBD2 be utilized in fungal-plant interaction studies?

Recombinant RBD2 offers multiple experimental applications for studying fungal-plant interactions:

  • Substrate identification in planta: Applying purified recombinant RBD2 to plant tissue extracts followed by comparative proteomics can identify potential natural substrates. Previous studies identified 120 F. graminearum proteins in planta during wheat head infection, with 49 proteins found exclusively under infection conditions . These represent candidate substrates or interaction partners for RBD2.

  • Antibody development: Purified recombinant RBD2 can be used to generate specific antibodies for immunolocalization studies to track the protein's distribution during infection processes. This approach can reveal spatial and temporal patterns of RBD2 expression and localization during pathogenesis.

  • Enzyme activity assays: Using recombinant RBD2 in enzymatic assays with synthetic substrates or plant proteins can characterize its proteolytic activity under different conditions, including pH, temperature, and ionic strength variations that mimic the plant apoplast during infection.

  • Protein-protein interaction studies: Recombinant RBD2 can be immobilized for pull-down assays or used in surface plasmon resonance experiments to identify and characterize interactions with both fungal and plant proteins, potentially revealing its role in the host-pathogen interface.

  • Plant defense induction experiments: Assessing whether recombinant RBD2 triggers plant defense responses can indicate if this protein serves as a pathogen-associated molecular pattern (PAMP) recognized by plant immune receptors, possibly explaining why some proteins lacking signal peptides are found in the plant apoplast during infection .

What analytical techniques are most appropriate for characterizing RBD2 structure-function relationships?

A multi-technique approach yields the most comprehensive characterization of RBD2 structure-function relationships:

  • X-ray crystallography and cryo-electron microscopy: These techniques can resolve the three-dimensional structure of RBD2, particularly challenging for membrane proteins. Sample preparation would require detergent solubilization or lipid nanodiscs to maintain native conformation.

  • Site-directed mutagenesis: Systematic mutation of key residues identified through sequence alignment with other characterized rhomboid proteases (such as the catalytic serine and histidine) can verify the catalytic mechanism and substrate specificity determinants.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can reveal dynamics and conformational changes in RBD2 upon substrate binding or inhibitor interaction without requiring crystallization.

  • Molecular dynamics simulations: Computational modeling based on structural data can predict how RBD2's exosite affects substrate specificity and catalytic efficiency, similar to studies on GlpG rhomboid protease showing that the exosite controls substrate unwinding and positioning .

  • Circular dichroism spectroscopy: This can assess secondary structure content and thermal stability of recombinant RBD2 under various conditions, including different detergents, pH values, and temperature ranges.

  • Activity-based protein profiling: Using activity-based probes specific for serine proteases can trap active RBD2 in complex biological samples and confirm its catalytic activity in native environments.

TechniqueApplicationExpected Outcome
X-ray crystallographyHigh-resolution structureAtomic coordinates of RBD2 structure
Site-directed mutagenesisFunctional residue identificationCritical residues for catalysis and specificity
HDX-MSConformational dynamicsRegions involved in substrate binding
MD simulationsMechanism predictionSubstrate interaction and catalytic models
Circular dichroismSecondary structure analysisα-helical content and thermal stability
Activity-based profilingActive enzyme detectionVerification of catalytic activity in complex samples

How can gene knockout or silencing approaches be used to elucidate RBD2 function in Fusarium graminearum?

Genetic manipulation approaches offer powerful insights into RBD2 function:

  • CRISPR-Cas9 gene editing: This technique can generate complete RBD2 knockout mutants in F. graminearum. Similar approaches were successfully used to create ΔGzChs5 and ΔGzChs7 mutants, revealing their roles in perithecia formation and pathogenicity .

  • RNA interference (RNAi): For partial silencing, RNAi constructs targeting RBD2 mRNA can create knockdown strains with reduced RBD2 expression, useful if complete knockout is lethal.

  • Complementation studies: After gene disruption, reintroducing wild-type or mutated versions of RBD2 can confirm phenotype specificity and identify essential functional domains.

  • Conditional expression systems: Inducible promoters controlling RBD2 expression enable temporal studies of its function during specific developmental stages or infection phases.

  • Phenotypic characterization protocol:

    • Morphological assessment: Evaluate hyphal growth rate, branching patterns, and microscopic features. GzCHS gene mutants formed balloon-shaped hyphae and intrahyphal hyphae with weakened cell walls .

    • Sexual reproduction analysis: Assess perithecia formation and ascospore production, as these structures are crucial for the pathogen's life cycle .

    • Virulence assays: Perform wheat head inoculation experiments to quantify infection efficiency, disease progression, and mycotoxin production.

    • Protein secretion analysis: Compare secretome profiles between wild-type and mutant strains using proteomics approaches similar to those that identified 289 secreted proteins in F. graminearum .

    • Cell wall integrity tests: Assess sensitivity to cell wall-disrupting agents, as RBD2 may process proteins involved in cell wall synthesis or maintenance .

What role might RBD2 play in mycotoxin production and regulation in Fusarium graminearum?

While direct evidence linking RBD2 to mycotoxin production is not explicitly provided in the search results, several experimental approaches can test this potential connection:

  • Comparative metabolomics: Analysis of mycotoxin profiles (particularly deoxynivalenol and zearalenone) in wild-type versus RBD2 knockout or knockdown mutants under mycotoxin-inducing conditions can establish whether RBD2 influences toxin biosynthesis.

  • Transcriptional analysis: RNA-seq or qRT-PCR comparing expression of genes in mycotoxin biosynthetic clusters between wild-type and RBD2-deficient strains can reveal if RBD2 affects transcriptional regulation of toxin production.

  • Proteolytic processing investigation: Since RBD2 is a protease, it may process enzymes or regulatory proteins in mycotoxin biosynthetic pathways. Targeted proteomics can identify potential RBD2 substrates within these pathways.

  • In planta studies: Infection experiments comparing mycotoxin accumulation in plant tissues infected with wild-type versus RBD2-deficient F. graminearum can determine if RBD2 affects toxin production during actual pathogenesis, which might differ from in vitro conditions.

  • Environmental response regulation: Testing whether RBD2 is involved in sensing environmental cues that trigger mycotoxin production (such as pH, plant metabolites, or nutrient availability) can reveal if it participates in signaling pathways that regulate toxin synthesis in response to host conditions.

Given that F. graminearum produces mycotoxins that cause shifts in amino acid composition of wheat, resulting in shriveled kernels and contamination with compounds that inhibit protein biosynthesis and cause various toxicological effects in humans and animals , understanding RBD2's potential role in this process could have significant implications for food safety and crop protection strategies.

What are the most promising research directions for understanding RBD2's role in fungal pathogenesis?

Based on current knowledge gaps and the biological significance of RBD2, several high-priority research directions emerge:

  • Substrate identification: Developing proteomics approaches to identify physiological substrates of RBD2, particularly focusing on the 49 proteins found exclusively in planta during wheat infection , could reveal direct mechanisms of pathogenesis.

  • Structural biology: Determining the three-dimensional structure of RBD2 would enable rational design of specific inhibitors and provide insights into its substrate specificity relative to other rhomboid proteases.

  • Gene regulation networks: Investigating how RBD2 expression is regulated during different stages of infection and in response to host defenses could reveal its temporal importance in the disease cycle.

  • Host-pathogen interface: Examining whether plant hosts have evolved mechanisms to detect or inhibit RBD2 activity as part of their immune response would place this protein in the broader context of plant-fungal co-evolution.

  • Functional conservation: Comparative studies of RBD2 homologs across different fungal pathogens could establish whether rhomboid proteases represent a conserved virulence mechanism that could be targeted for broad-spectrum fungal disease control.

These research directions are particularly significant given that despite great efforts to find resistance genes against F. graminearum, no completely resistant variety is currently available , making understanding of pathogenesis mechanisms crucial for developing alternative control strategies.

How might understanding RBD2 function contribute to developing novel antifungal strategies?

Insights into RBD2 biology offer multiple pathways toward innovative fungal disease management:

  • Target-based inhibitor design: Structure-based design of specific inhibitors targeting RBD2's catalytic mechanism could lead to novel fungicides with reduced environmental impact compared to broad-spectrum agents. The non-competitive inhibition mechanism observed with peptidyl aldehydes in related rhomboid proteases provides a starting point for such designs .

  • Host resistance engineering: If RBD2 processes specific substrates essential for virulence, engineering crop plants to express proteins that competitively inhibit these interactions could confer resistance without modifying the plant's native proteins.

  • Blocking exosite interactions: Given the importance of the exosite in rhomboid protease function , developing molecules that specifically bind this region could inhibit RBD2 activity without affecting other serine proteases, potentially offering high selectivity.

  • Diagnostic tools: Antibodies or aptamers specific to RBD2 could enable early detection of F. graminearum infection in field conditions before visible symptoms appear, allowing timely application of control measures.

  • Vaccination strategies: For livestock consuming potentially contaminated feed, understanding RBD2's role in mycotoxin production could inform development of feed additives that neutralize these toxins or inhibit their absorption in the digestive tract.

These approaches address the significant economic impact of fusarium head blight, which causes billions of dollars in losses worldwide through reduced yields and contamination with mycotoxins that cause vomiting, liver damage, and reproductive defects in livestock .

What interdisciplinary approaches would be most valuable for comprehensive characterization of RBD2?

Integrating multiple scientific disciplines can accelerate understanding of RBD2:

  • Structural biology and computational chemistry: Combining crystallography with advanced molecular dynamics simulations can elucidate how the exosite of RBD2 controls substrate specificity and catalytic efficiency, similar to studies on GlpG rhomboid protease .

  • Systems biology and proteomics: Network analysis using the Fusarium graminearum protein-protein interaction database (containing 223,166 interactions among 7,406 proteins) integrated with secretome data (289 identified proteins) can position RBD2 within cellular pathways.

  • Plant pathology and immunology: Investigating whether RBD2 or its processed substrates trigger plant immune responses can reveal its role at the host-pathogen interface and potentially identify natural plant inhibitors.

  • Synthetic biology and protein engineering: Creating modified versions of RBD2 with altered specificity or activity can test hypotheses about its function and potentially develop proteins with biotechnological applications.

  • Agronomic science and field testing: Translating laboratory findings to field conditions by testing RBD2-targeted interventions under diverse environmental conditions and in different crop varieties can assess practical applicability.

  • Food science and toxicology: Examining connections between RBD2 activity and mycotoxin production can address food safety concerns related to contaminated grains causing harmful effects in humans and livestock .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.