Recombinant Gibbon hepatitis B virus subtype ayw3q Large envelope protein (S)

Shipped with Ice Packs
In Stock

Description

Functional Roles in HBV Infection

The Large S protein governs multiple stages of the HBV lifecycle:

Viral Entry

  • The Pre-S1 domain binds sodium taurocholate co-transporting polypeptide (NTCP) on hepatocytes, initiating infection .

  • Hydrophobic regions (residues 50–70) facilitate membrane fusion .

Particle Assembly

  • Interacts with γ2-adaptin to direct subviral particle trafficking .

  • Bends membranes via its amphipathic helices to promote virion budding .

Immune Evasion

  • Phosphorylation at S6 and S98 modulates epitope exposure, potentially dampening antibody responses .

Host Specificity Determinants

  • Residues 21–30 in Pre-S1 dictate species tropism. Substituting this region with human HBV sequences restores infectivity in human hepatocytes .

  • Myristoylation-deficient mutants lose >90% infectivity, underscoring its role in entry .

Phosphorylation Landscape

  • Nine phosphorylation sites identified via mass spectrometry and NMR, with S6 and S98 as major targets .

  • Phosphomimetic mutations (S/T→E) disrupt interactions with Hsc70, impairing capsid envelopment .

Recombinant Applications

  • ELISA Development: Used in diagnostic kits (e.g., MBS1087135) to detect HBV surface antibodies .

  • Structural Studies: Serves as a substrate for resolving Pre-S1 conformational dynamics .

Comparative Analysis with Other HBV Proteins

ProteinFunctionExpression SystemKey Feature
Large S (L)Receptor binding, virion assemblyE. coli, mammalian cellsPre-S1/Pre-S2 domains
Middle S (M)Immune modulationYeast, baculovirusPre-S2 domain only
Small S (S)Major surface antigenMammalian cellsAntigenic loop dominant

Data derived from HBV genotype A–F variants .

Challenges and Future Directions

  • Limitations: The recombinant protein lacks native glycosylation patterns due to E. coli expression, reducing its utility in vaccine studies .

  • Opportunities:

    • Engineering chimeric proteins with human HBV Pre-S1 to study cross-species transmission .

    • Leveraging phosphorylation mimics to map host-pathogen interactions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of that tag.
Synonyms
S; Large envelope protein; L glycoprotein; L-HBsAg; LHB; Large S protein; Large surface protein; Major surface antigen
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-389
Protein Length
Full Length of Mature Protein
Species
Gibbon hepatitis B virus subtype ayw3q (isolate Hope) (HBVgbn)
Target Names
S
Target Protein Sequence
GQNLSVSNPLGFFPEHQLDPLFKANSNNPDWDFNPNKDNWPEATKVGVGAFGPGFTPPHG GLLGWSSQAQGAITTLPALPPPAATNRQSGRQPTPISPPLRDTHPQAMKWNSTVFHQTLQ DPRVRGLYFPVGGSSSGTVNPVPTTASHISSIFSRTGDPAPNMENITSGFLGPLLVLQAG FFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLR RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTITAQGTSLYPSCC CTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFAGLSPTAWLLVIWMI WYWGPNLYNILNPFIPLLPIFFCLWVYI
Uniprot No.

Target Background

Function
The large envelope protein exists in two topological conformations: 'external' (Le-HBsAg) and 'internal' (Li-HBsAg). In its external conformation, the protein binds to cell receptors, initiating infection. This interaction determines the species specificity and liver tropism. This binding induces virion internalization primarily through caveolin-mediated endocytosis. The large envelope protein also facilitates fusion between the virion membrane and the endosomal membrane. In its internal conformation, the protein contributes to virion morphogenesis and mediates contact with the nucleocapsid, functioning as a matrix protein. The middle envelope protein plays a crucial role in the budding of the virion. It is involved in the induction of budding in a nucleocapsid-independent manner. During this process, the majority of envelope proteins bud to form subviral lipoprotein particles measuring 22 nm in diameter, devoid of a nucleocapsid.
Protein Families
Orthohepadnavirus major surface antigen family
Subcellular Location
Virion membrane.

Q&A

What are the key functional domains of the PreS1 region and their significance?

The PreS1 domain contains several functionally important regions:

  • N-terminal receptor binding region (first 48 amino acids): Interacts with the sodium taurocholate co-transporting polypeptide (NTCP), which serves as the HBV receptor. N-terminal myristoylation at this site is crucial for receptor binding and infectivity .

  • Hydrophobic region (residues 50-70): Contains several hydrophobic stretches that may be involved in membrane interaction. Recent models suggest this region could function as a fusion peptide facilitating viral entry .

  • PreS1/PreS2 border region (approximately residues 90-120): Implicated in interactions with the viral capsid during particle formation, which is essential for proper virus assembly .

  • Hsc70 chaperone interaction site: Located within PreS1, this site mediates interaction with the Hsc70 chaperone, which appears to be important for the i-PreS orientation observed in immature viral particles .

Understanding these domains is crucial as they represent potential targets for antiviral strategies and contribute to our understanding of viral tropism and pathogenesis.

How is recombinant Gibbon Hepatitis B Virus Large Envelope Protein prepared and stored?

Recombinant production typically involves expressing the protein in E. coli with an N-terminal His tag to facilitate purification . The expression construct contains the full-length mature protein sequence (amino acids 2-389).

Storage and handling recommendations:

  • Upon receipt, the lyophilized protein should be briefly centrifuged and stored at -20°C/-80°C

  • For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50%) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0

For optimal results, avoid repeated freeze-thaw cycles as this can degrade protein quality and compromise experimental outcomes.

What phosphorylation sites have been identified in Hepatitis B Virus Large Envelope Protein and how can they be studied?

Mass spectrometry and NMR analyses have identified multiple phosphorylation sites in the PreS domain of the HBV Large envelope protein. The confirmed phosphorylation sites include:

  • Major sites: S6 and S98

  • Additional confirmed sites: T57, S67, T95, and S148

  • Possible but unconfirmed sites: T7, S8, T76, S85, and T86

Methodological approaches for studying phosphorylation:

  • Cell-free protein synthesis (CFPS): Wheat germ extract CFPS systems have been effectively used to produce phosphorylated HBV L protein, utilizing endogenous kinases in the extract .

  • Co-expression with kinases: Expression in E. coli with co-expression of MAPK14 kinase has successfully produced phosphorylated variants .

  • Analytical techniques:

    • LC-MS/MS mass spectrometry for identification of specific phosphorylation sites

    • MALDI-TOF analyses for quantitative assessment of phosphorylation levels

    • NMR for structural characterization of phosphorylated domains

  • Phosphomimetic mutations: Since full phosphorylation is difficult to achieve in recombinant systems, S/T to E mutations provide an effective strategy to mimic phosphorylation for functional studies .

These phosphorylation sites are distributed across all major functional regions of PreS, suggesting potential regulatory roles in various viral functions, although their precise significance remains to be fully elucidated.

How does phylogenetic analysis inform our understanding of Gibbon Hepatitis B Virus in relation to human HBV strains?

Phylogenetic analyses of Gibbon HBV isolates have yielded important insights regarding evolutionary relationships and cross-species transmission:

  • Sequence similarity: The amino acid sequences of core and surface genes from Gibbon HBV isolates are remarkably similar to human HBV isolates. This high degree of similarity suggests relatively recent cross-species transmission events rather than long-term co-evolution .

  • Phylogenetic positioning: Analyses indicate that Gibbon HBV isolates cluster within the human HBV family rather than forming a distinct branch. This positioning strongly suggests that these viruses likely originated from human sources and subsequently infected captive gibbons .

  • Epidemiological implications: A serological analysis of 30 captive gibbons revealed that 47% were positive for at least one marker of ongoing or previous HBV infection, with approximately half of the exposed animals developing chronic infections .

For conducting phylogenetic analyses, researchers typically:

  • Amplify core and surface genes directly from serum-derived virion DNA

  • Sequence PCR products directly to avoid cloning artifacts

  • Align sequences with representative human isolates from different genotypes

  • Construct phylogenetic trees using maximum likelihood or Bayesian methods

  • Include relevant outgroups such as woolly monkey HBV (WMHBV)

These approaches enable assessment of cross-species transmission risk and provide insights into host range determinants.

What experimental systems can be used to study the host specificity and infectivity determinants of the Large Envelope Protein?

Several complementary experimental systems have proven valuable for investigating host specificity and infectivity determinants:

  • In vitro infection systems with primary hepatocytes:

    • Primary human hepatocytes for studying human-tropic variants

    • Primary spider monkey or other primate hepatocytes for studying species specificity

    • Dose-dependent infection assays with recombinant viral particles to quantify infectivity

  • HDV (Hepatitis Delta Virus) model system:

    • Uses HDV particles pseudotyped with HBV envelope proteins

    • Allows titration of infectivity in various primary hepatocyte cultures

    • Particularly valuable for characterizing the roles of envelope glycoproteins

  • Chimeric envelope proteins:

    • Creation of chimeras between HBV and WMHBV (woolly monkey HBV) L proteins

    • Exchange of specific domains (e.g., first 40 amino acids of pre-S1) between viruses with different host ranges

    • Analysis of resulting pseudotyped particles' infectivity

  • Inhibition studies with peptides:

    • Synthetic peptides based on pre-S1 domain

    • Competitive inhibition assays to identify regions critical for receptor binding

    • Dose-response curves to quantify inhibitory potency

These approaches have revealed that the N-terminal region of pre-S1 is crucial but not sufficient for determining host range, with downstream sequences also contributing significantly to infectivity profiles .

What are the key considerations for designing mutagenesis studies of the PreS1 domain?

When designing mutagenesis studies of the PreS1 domain, researchers should consider the following:

  • Targeted regions for mutagenesis:

    • N-terminal myristoylation site (critical for infectivity)

    • NTCP receptor binding region (first 48 amino acids)

    • Hydrophobic region between residues 50-70 (potential fusion peptide)

    • PreS1/PreS2 border (capsid interaction region)

  • Types of mutations to consider:

    • Alanine scanning mutagenesis for systematic functional mapping

    • Conservative vs. non-conservative substitutions to assess amino acid property requirements

    • Deletion mutants to identify essential regions

    • Domain swapping between viruses with different host ranges

    • Phosphomimetic mutations (S/T to E) to simulate phosphorylation states

  • Functional assays to assess mutant phenotypes:

    • Receptor binding assays

    • Cell entry assays using pseudotyped particles

    • Membrane fusion assays

    • Particle assembly and secretion analyses

    • Cross-linking studies for protein-protein interactions

  • Technical considerations:

    • Expression systems that preserve post-translational modifications

    • Verification of proper protein folding after mutation

    • Inclusion of wild-type controls and established mutant controls

    • Quantitative rather than qualitative assessments of function

A methodical, structure-informed approach to mutagenesis can provide crucial insights into the molecular mechanisms underlying PreS1 domain functions.

What techniques are most effective for analyzing post-translational modifications of the Large Envelope Protein?

Post-translational modifications (PTMs) of the Large Envelope Protein, particularly myristoylation and phosphorylation, are critical for its function. The following techniques have proven effective for analyzing these modifications:

  • Mass Spectrometry Approaches:

    • LC-MS/MS: Provides unambiguous identification of phosphorylation sites and other PTMs. Particularly effective when combined with phosphopeptide enrichment strategies .

    • MALDI-TOF: Useful for rapid screening and quantitative assessment of modification states .

  • Protein Production Systems that Preserve PTMs:

    • Wheat germ cell-free protein synthesis (WG-CFPS): Preserves phosphorylation due to endogenous kinases in the extract.

    • Mammalian expression systems: More likely to correctly process myristoylation and complex glycosylation.

    • Co-expression with modifying enzymes: E.g., co-expression with MAPK14 kinase for phosphorylation .

  • Specific Analytical Techniques:

    • NMR spectroscopy: Provides atomic-level information about the structural impact of modifications.

    • Click chemistry approaches: For detection of lipid modifications like myristoylation.

    • Immunological detection: Using modification-specific antibodies.

    • Mobility shift assays: For detection of phosphorylation states .

  • Software Tools for PTM Analysis:

    • Database search algorithms specifically designed for PTM identification

    • Probability-based scoring systems for modification site assignment

    • Quantitative tools for assessing stoichiometry of modifications

The combination of these approaches allows comprehensive characterization of the PTM landscape of the Large Envelope Protein, which is essential for understanding its functional dynamics.

How can protein-protein interactions of the Large Envelope Protein be studied in research settings?

Several complementary methodologies can be employed to study protein-protein interactions involving the Large Envelope Protein:

  • Co-immunoprecipitation (Co-IP):

    • Utilizes antibodies against the Large Envelope Protein or its interaction partners

    • Can be performed with native proteins from infected cells or with recombinant proteins

    • Western blotting confirms the presence of interacting proteins

  • Pull-down assays:

    • Leverages the His-tag on recombinant proteins for affinity purification

    • Particularly useful for studying interactions with viral capsid proteins or host factors like Hsc70

  • Yeast two-hybrid screening:

    • Allows unbiased identification of novel interaction partners

    • Can be followed by validation with more direct methods

  • Surface Plasmon Resonance (SPR):

    • Provides quantitative binding kinetics and affinity measurements

    • Can be used to study interactions with purified receptor proteins or antibodies

  • Fluorescence techniques:

    • Förster Resonance Energy Transfer (FRET) for studying interactions in living cells

    • Fluorescence correlation spectroscopy for single-molecule interaction studies

  • Proximity labeling methods:

    • BioID or APEX2-based approaches for identifying proteins in close proximity

    • Useful for identifying transient or weak interactions in cellular contexts

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM of protein complexes

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for mapping interaction interfaces

These methods can reveal the molecular basis of interactions with host receptors (e.g., NTCP), chaperones (e.g., Hsc70), and viral components (e.g., capsid), providing insights into virus assembly, entry, and host range determination .

What are the recommended approaches for studying the membrane fusion properties of the Large Envelope Protein?

The hydrophobic region (residues 50-70) of the PreS1 domain has been proposed to function as a fusion peptide . Several methodologies can be employed to investigate these fusion properties:

  • Liposome-based fusion assays:

    • Preparation of liposomes with specific lipid compositions mimicking target membranes

    • Incorporation of fluorescent lipids for FRET-based fusion monitoring

    • Assessment of fusion kinetics under varying pH conditions to identify fusion triggers

    • Analysis of lipid mixing versus content mixing to distinguish hemifusion from complete fusion

  • Cell-cell fusion assays:

    • Expression of viral envelope proteins in one cell population

    • Co-culture with receptor-expressing target cells

    • Microscopic visualization of syncytia formation or quantitative reporter-based readouts

    • Analysis of fusion dependence on receptor expression and environmental conditions

  • Biophysical characterization of fusion peptides:

    • Circular dichroism spectroscopy to assess secondary structure changes upon membrane interaction

    • Fluorescence spectroscopy to monitor membrane insertion

    • Atomic force microscopy to visualize membrane perturbations

    • Isothermal titration calorimetry for thermodynamic parameters of membrane binding

  • Mutagenesis approaches:

    • Systematic mutation of hydrophobic residues in the 50-70 region

    • Analysis of the impact on fusion activity and infectivity

    • Comparison with established viral fusion peptides

    • Chimeric constructs exchanging putative fusion regions between viral species

  • Structural analysis:

    • NMR structural studies of the isolated peptide in membrane-mimetic environments

    • Computational modeling and molecular dynamics simulations of membrane interactions

    • Cryo-electron microscopy of fusion intermediates

These approaches can collectively provide insights into the fusion mechanism, which remains one of the less understood aspects of hepadnavirus entry.

What are the major challenges in producing fully functional recombinant Large Envelope Protein for research?

Production of fully functional recombinant Large Envelope Protein presents several significant challenges:

  • Post-translational modification fidelity:

    • Achieving proper N-terminal myristoylation, which is critical for infectivity

    • Obtaining complete and accurate phosphorylation patterns

    • Research indicates that neither E. coli-based expression nor wheat germ cell-free systems provide full phosphorylation

  • Protein solubility and folding:

    • The hydrophobic nature of the protein leads to solubility issues

    • Maintaining native conformation during purification processes

    • Preventing aggregation while achieving sufficient concentration

  • Replicating membrane environment:

    • The protein naturally exists in a lipid membrane environment

    • Reconstitution into appropriate membrane mimetics is challenging

    • Function may depend on specific lipid compositions

  • Expression system limitations:

    • E. coli systems lack eukaryotic post-translational modification machinery

    • Mammalian systems may produce low yields

    • Insect cell systems may introduce non-native glycosylation patterns

  • Methodological alternatives:

    • Phosphomimetic mutations (S/T to E substitutions) represent a viable strategy to simulate phosphorylation states for structural studies

    • Domain-specific expression rather than full-length protein

    • Co-expression with modifying enzymes or chaperones

Future advances in protein engineering and expression technologies may help overcome these limitations and provide more faithful recombinant versions of the protein.

How can researchers assess the impact of phosphorylation on Large Envelope Protein function?

Given the identification of multiple phosphorylation sites in the PreS domain (S6, T57, S67, T95, S98, S148) , assessing their functional impact requires systematic approaches:

  • Phosphomimetic mutation strategies:

    • Substitution of serine/threonine residues with glutamic acid to mimic phosphorylation

    • Substitution with alanine to prevent phosphorylation

    • Creation of single, double, and combinatorial mutants to assess additive or synergistic effects

    • Integration of mutations into pseudoviruses or recombinant viruses

  • Functional assays:

    • Receptor binding assays to determine if phosphorylation affects interaction with NTCP

    • Viral entry assays using pseudotyped particles with mutant envelope proteins

    • Capsid interaction studies to assess impact on virus assembly

    • Subcellular localization studies to examine trafficking behaviors

  • Structural analyses:

    • NMR studies comparing phosphorylated/unphosphorylated states or phosphomimetic mutants

    • Hydrogen-deuterium exchange mass spectrometry to detect conformational changes

    • Small-angle X-ray scattering to assess larger-scale structural impacts

  • Systems biology approaches:

    • Identification of kinases responsible for each phosphorylation event

    • Analysis of phosphorylation dynamics during viral lifecycle

    • Integration with cellular signaling pathways

  • Model systems:

    • HDV model system for infectivity studies

    • Primary hepatocyte cultures from different species for host range studies

    • Animal models for in vivo relevance

Since phosphorylation sites occur in all major functional regions of PreS, they may play regulatory roles in various aspects of viral function, including receptor binding, membrane fusion, and capsid interactions .

What are promising directions for developing antivirals targeting the Large Envelope Protein?

The Large Envelope Protein, particularly its PreS1 domain, represents an attractive target for antiviral development due to its essential roles in viral entry and assembly. Promising research directions include:

  • Entry inhibitors targeting the NTCP binding site:

    • Peptides derived from the N-terminal region of PreS1

    • Small molecules that competitively inhibit the PreS1-NTCP interaction

    • Antibodies targeting the receptor-binding domain

    • Therapeutic approaches could be modeled after inhibition studies that have demonstrated efficacy in blocking infection

  • Fusion inhibitors:

    • Compounds targeting the hydrophobic region (residues 50-70) proposed to function in membrane fusion

    • Peptidomimetics that interfere with conformational changes required for fusion

    • Design informed by structural characterization of the fusion mechanism

  • Assembly inhibitors:

    • Molecules that disrupt the interaction between PreS1/PreS2 border region and viral capsid

    • Compounds that interfere with L protein oligomerization

  • Phosphorylation modulators:

    • Kinase inhibitors that prevent critical phosphorylation events

    • Design informed by comprehensive mapping of phosphorylation sites and their functional impacts

  • Host factor targeting:

    • Compounds that modulate the activity of Hsc70 or other chaperones that interact with PreS1

    • Small molecules affecting post-translational modification enzymes critical for L protein function

  • Combination approaches:

    • Synergistic combinations of agents targeting different aspects of L protein function

    • Integration with other antiviral strategies targeting different viral components

The detailed structural and functional characterization of the Large Envelope Protein provides a foundation for rational drug design approaches that could lead to new therapeutic options for hepatitis B infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.